Новости лаборатории Наномир

  Все выпуски  

807 Почему Институт белка не может воспользоваться пикотехнологией 2D?


Выпуск 807

Лаборатория Наномир

Когда реальность открывает тайны,
уходят в тень и  меркнут чудеса ...

Почему Институт белка не может воспользоваться пикотехнологией 2D?

Для тех, кто далёк от структурной биологии, но хочет понять, почему экономический эффект от внедрения пикотехнологии белков может превысить 10 в 19 степени рублей, популярно на ютубе и копия на яндексе.

 

Переписка со специалистом из Института белка. Ответ из Института белка пришёл сразу после письма из администрации президента России.

15 июля 2019 г. в 19:19 Специалист Института белка:

Тема: По объявлению на сайте https://nano-world-articles.nethouse.ru/services/pikotekhnologicheskie-3d-modeli-belkov-na-zakaz

Здравствуйте!

Можете ли Вы выполнить на заказ молекулярно-динамическое моделирование структуры белка (есть pdb файл с трехмерной структурой) при трех разных температурах?

И если да, то сколько это будет стоить?

--

С уважением,

Специалист Института белка

***

16 июля 2019 г. в 1:54 Александр Кушелев:

Здравствуйте, Специалист Института белка!

Наша технология позволяет определить структуру белка в том виде, в котором она сходит с рибосомы. Для этого нам нужна кодирующая нуклеотидная последовательность в стандарте fasta. Типа такой: ggaggcgggggt...

Вторичные структуры любого количества белков мы сможем определять для Вас за наш счёт в течение одного рабочего дня.

С третичными и четвертичными структурами не всё так просто, поэтому может получиться автоматически, а может быть придётся моделировать вручную.

Присылайте коды. Начнём со вторичных структур. Обычно вторичные структуры практически не меняются вплоть до денатурации белка.

В отличие от РСА и др. методов вторичную структуру новая технология позволяет определить почти со 100%-ной надежностью.

Если результаты новой технологии Вам понравятся, то будем стараться выполнять для Вас все ваши требования. Дело в том, что в ручном режиме с помощью пикотехнологических модельных установок можно смоделировать даже химические реакции в конкретных пространственно-временных масштабах. Если дело дойдёт до трудоёмкой работы, тогда уже может встать вопрос об оплате. До этого всё за наш счёт.

С уважением,

Ваш Александр Кушелев,

Руководитель лаб. Наномир

8-926-5101703

8-903-2003424

***

16 июля 2019 г. в 12:09 Специалист Института белка:

Здравствуйте!

Аминокислотную последовательность можно взять здесь: https://swissmodel.expasy.org/repository/uniprot/Q704Y3?csm=EB50780E9281C2B7 

или из прикрепленного pdb файла.

Это белок терморецептора. Нам нужно узнать как будет изменяться конформация этого белка при повышении температуры.

Нужно взять температуру 310, 415 и 420 К.

TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)

TITLE    2 Untitled Project

EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)

AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)

REVDAT   1   07-JUN-19 1MOD    1       06:47

JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,

JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,

JRNL        AUTH 3 R.LEPORE,T.SCHWEDE

JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND

JRNL        TITL 2 COMPLEXES

JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018

JRNL        PMID   29788355

JRNL        DOI    10.1093/nar/gky427

REMARK   1

REMARK   1 REFERENCE 1

REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,

REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE

REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY

REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  22       2017

REMARK   1  REFN                   ISSN 0305-1048

REMARK   1  PMID   27899672

REMARK   1  DOI    10.1093/nar/gkw1132

REMARK   1

REMARK   1 REFERENCE 2

REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE

REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH

REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE

REMARK   1  REF    ELECTROPHORESIS               V.  30       2009

REMARK   1  REFN                   ISSN 0173-0835

REMARK   1  PMID   19517507

REMARK   1  DOI    10.1002/elps.200900140

REMARK   1

REMARK   1 REFERENCE 3

REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE

REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL

REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS

REMARK   1  REF    BIOINFORMATICS                V.  27       2011

REMARK   1  REFN                   ISSN 1367-4803

REMARK   1  PMID   21134891

REMARK   1  DOI    10.1093/bioinformatics/btq662

REMARK   1

REMARK   1 REFERENCE 4

REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE

REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND

REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY

REMARK   1  REF    SCI.REP.                      V.   7       2017

REMARK   1  REFN                   ISSN

REMARK   1  PMID   28874689

REMARK   1  DOI    10.1038/s41598-017-09654-8

REMARK   1

REMARK   1 DISCLAIMER

REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.

REMARK   1 The results of any theoretical modelling procedure is

REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may

REMARK   1 contain significant errors. This is especially true for automated

REMARK   1 modeling since there is no human intervention during model

REMARK   1 building. Please read the header section and the logfile carefully

REMARK   1 to know what templates and alignments were used during the model

REMARK   1 building process. All information by the SWISS-MODEL SERVER is

REMARK   1 provided "AS-IS", without any warranty, expressed or implied.

REMARK   2

REMARK   2 COPYRIGHT NOTICE

REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the

REMARK   2 SWISS-MODEL server, developed by the Computational Structural

REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the

REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This

REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons

REMARK   2 Attribution-ShareAlike 4.0 International License

REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you

REMARK   2 can copy and redistribute the model in any medium or format,

REMARK   2 transform and build upon the model for any purpose, even

REMARK   2 commercially, under the following terms:

REMARK   2 Attribution - You must give appropriate credit, provide a link to

REMARK   2 the license, and indicate if changes were made. You may do so in any

REMARK   2 reasonable manner, but not in any way that suggests the licensor

REMARK   2 endorses you or your use. When you publish, patent or distribute

REMARK   2 results that were fully or partially based on the model, please cite

REMARK   2 the corresponding papers mentioned under JRNL.

REMARK   2 ShareAlike - If you remix, transform, or build upon the material,

REMARK   2 you must distribute your contributions under the same license as the

REMARK   2 original.

REMARK   2 No additional restrictions - you may not apply legal terms or

REMARK   2 technological measures that legally restrict others from doing

REMARK   2 anything the license permits.

REMARK   2 Find a human-readable summary of (and not a substitute for) the

REMARK   2 CC BY-SA 4.0 license at this link:

REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/

REMARK   3 

REMARK   3 MODEL INFORMATION

REMARK   3  ENGIN   PROMOD3

REMARK   3  VERSN   1.3.0

REMARK   3  OSTAT   homo-tetramer

REMARK   3  OSRSN   PREDICTION

REMARK   3  QSPRD   0.759

REMARK   3  QMN4    -3.00

REMARK   3  MODT    FALSE

REMARK   3 

REMARK   3 TEMPLATE 1

REMARK   3  PDBID   3j5p

REMARK   3  CHAIN   B

REMARK   3  MMCIF   A

REMARK   3  PDBV    2019-05-24

REMARK   3  SMTLE   3j5p.1.A

REMARK   3  SMTLV   2019-05-29

REMARK   3  MTHD    ELECTRON MICROSCOPY 0.00 A

REMARK   3  FOUND   BLAST

REMARK   3  SIM     0.59

REMARK   3  SID     98.12

REMARK   3  OSTAT   homo-tetramer

REMARK   3  ALN A TRG MEKWASLDSDESEPPAQENSCPDPPDRDPNSKPPPAKPHIFATRSRTRLFGKGDSEEA

REMARK   3  ALN A TRG SPMDCPYEEGGLASCPIITVSSVVTLQRSVDGPTCLRQTSQDSVSTGVETPPRLYDRR

REMARK   3  ALN A TRG SIFDAVAQSNCQELESLLSFLQKSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTI

REMARK   3  ALN A TRG ALLLDIARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMALVTLLVENGADVQAAA

REMARK   3  ALN A TRG NGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLH

REMARK   3  ALN A TRG ALVEVADNTADNTKFVTNMYNEILILGAKLHPTLKLEELTNKKGLTPLALAASSGKIG

REMARK   3  ALN A TRG VLAYILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSE

REMARK   3  ALN A TRG TPNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFFVYCLYMIIFTTAAYYRPVEGLPPY

REMARK   3  ALN A TRG KLNNTVGDYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSLKSLFVDSYSEILFFVQSL

REMARK   3  ALN A TRG FMLVSVVLYFSHRKEYVASMVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCR

REMARK   3  ALN A TRG FMFVYLVFLFGFSTAVVTLIEDGKNNSLPVESPPHKCRGSACRPGNSYNSLYSTCLEL

REMARK   3  ALN A TRG FKFTIGMGDLEFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKN

REMARK   3  ALN A TRG IWKLQRAITILDTEKSFLKCMRKAFRSGKLLQVGFTPDGKDDFRWCFRVDEVNWTTWN

REMARK   3  ALN A TRG TNVGIINEDPGNCEGVKRTLSFSLRSGRVSGRNWKNFALVPLLRDASTRDRHSTQPEE

REMARK   3  ALN A TRG VQLKHYTGSLKPEDAEVFKDSMAPGEK

REMARK   3  ALN A TPL ----------------------------------------------------------

REMARK   3  ALN A TPL -----------------------------------------------------LYDRR

REMARK   3  ALN A TPL SIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTI

REMARK   3  ALN A TPL ALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAA

REMARK   3  ALN A TPL NGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLH

REMARK   3  ALN A TPL ALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIG

REMARK   3  ALN A TPL VLAYILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSE

REMARK   3  ALN A TPL TPNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPY

REMARK   3  ALN A TPL KLKNTVGDYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSLKSLFVDSYSEILFFVQSL

REMARK   3  ALN A TPL FMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCR

REMARK   3  ALN A TPL FMFVYLVFLFGFSTAVVTLIEDGK-----------------------YNSLYSTCLEL

REMARK   3  ALN A TPL FKFTIGMGDLEFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKN

REMARK   3  ALN A TPL IWKLQRAITILDTEKSFLKCMRKA----------------------------------

REMARK   3  ALN A TPL ----------------------------------------------------------

REMARK   3  ALN A TPL ---------------------------

REMARK   3  ALN A OFF 0

ATOM      1  N   LEU A 112     -22.185  63.216  48.095  1.00  0.66           N  

ATOM      2  CA  LEU A 112     -22.842  63.093  46.755  1.00  0.66           C  

ATOM      3  C   LEU A 112     -22.194  61.985  45.967  1.00  0.66           C  

...

ATOM  19579  OXT ALA D 720       4.020  47.380  11.105  1.00  0.47           O  

TER   19580      ALA D 720                                                      

END   


***

16 июля 2019 г. в 16:00 Александр Кушелев: 

Здравствуйте, Специалист Института белка!

Я нашёл кодирующую нуклеотидную последовательность здесь: https://www.ebi.ac.uk/ena/data/view/AAS15574&display=fasta

Вкладываю её в это письмо.

Если это код другого белка, нужно будет найти код Вашего.

А пока я попробую определить структуру по найденной кодирующей нуклеотидной последовательности.

С уважением,

Ваш А.Кушелев

>ENA|AAS15574|AAS15574.1 Mus musculus (house mouse) TRPV1alpha

ATGGAGAAATGGGCTAGCTTAGACTCGGATGAATCTGAGCCCCCAGCCCAAGAGAACTCC

TGCCCGGACCCTCCAGACAGAGACCCTAACTCCAAGCCGCCTCCAGCCAAGCCCCACATC

TTTGCTACCAGGAGTCGCACCCGGCTTTTTGGGAAGGGTGACTCAGAAGAGGCCTCTCCC

ATGGACTGCCCTTATGAGGAAGGCGGGCTGGCCTCCTGCCCTATCATCACCGTCAGCTCT

GTTGTCACTCTCCAGAGGTCTGTGGATGGACCTACCTGTCTCAGGCAGACATCCCAGGAC

TCTGTCTCCACTGGTGTTGAGACGCCCCCAAGGCTCTATGATCGCAGGAGCATCTTCGAC

GCTGTGGCTCAGAGCAACTGCCAGGAGCTGGAGAGCCTGCTGTCCTTCCTGCAGAAGAGC

AAGAAGCGCCTGACTGACAGCGAGTTCAAAGACCCAGAGACGGGAAAGACCTGTCTGCTC

AAAGCCATGCTCAATCTGCACAATGGGCAGAACGACACCATTGCTCTGCTCCTGGACATT

GCCCGGAAGACAGATAGCCTGAAGCAGTTTGTCAATGCCAGCTACACAGACAGCTACTAC

AAGGGCCAGACAGCATTACACATTGCCATTGAAAGGCGGAACATGGCACTGGTGACCCTC

TTGGTGGAGAATGGAGCAGATGTCCAGGCTGCTGCTAACGGGGACTTCTTCAAGAAAACC

AAAGGGAGGCCTGGCTTCTACTTTGGTGAGCTGCCCCTGTCCCTGGCTGCGTGCACCAAC

CAGCTGGCCATTGTGAAGTTCCTGCTGCAGAACTCCTGGCAGCCTGCAGACATCAGTGCA

CGGGATTCGGTGGGCAACACGGTGCTGCACGCCCTTGTGGAGGTGGCAGATAACACAGCT

GACAACACCAAGTTCGTGACAAACATGTACAACGAGATCCTGATCCTGGGGGCCAAACTC

CACCCCACACTGAAGCTAGAAGAACTCACCAACAAGAAGGGGCTTACACCGCTGGCTCTG

GCTGCCAGCAGTGGGAAGATTGGGGTCTTGGCCTACATTCTCCAGAGGGAGATCCACGAA

CCAGAGTGCCGGCACCTGTCCAGGAAGTTCACTGAATGGGCCTATGGGCCCGTGCACTCC

TCCCTTTATGACCTGTCCTGCATTGACACCTGTGAGAAGAATTCAGTGCTGGAGGTGATC

GCCTACAGTAGCAGTGAGACCCCCAACCGCCACGACATGCTTCTCGTGGAGCCCTTGAAC

CGACTCCTGCAGGACAAGTGGGACAGATTTGTCAAGCGCATCTTCTACTTCAACTTCTTC

GTCTACTGCTTGTATATGATCATCTTCACCACGGCTGCTTACTATCGGCCTGTGGAAGGC

TTGCCCCCCTATAAGCTGAATAACACCGTTGGGGACTATTTCCGTGTCACTGGAGAGATC

CTGTCTGTGTCAGGAGGAGTCTACTTCTTCTTCCGAGGGATCCAGTATTTCCTGCAGAGG

CGACCATCCCTCAAGAGTTTGTTTGTGGACAGCTACAGTGAGATACTTTTCTTTGTACAG

TCACTGTTCATGCTGGTGTCTGTGGTACTGTACTTCAGCCATCGCAAGGAGTATGTGGCT

TCCATGGTGTTCTCCCTGGCCATGGGCTGGACCAACATGCTCTACTACACCCGAGGATTC

CAGCAGATGGGCATCTATGCTGTCATGATTGAGAAGATGATCCTCAGAGACCTGTGTCGG

TTTATGTTCGTCTACCTCGTGTTCTTGTTTGGATTTTCCACAGCCGTAGTGACACTGATC

GAGGATGGGAAGAATAACTCACTGCCTGTGGAGTCCCCACCACACAAGTGTCGGGGATCT

GCCTGCAGGCCAGGTAACTCTTACAACAGCCTGTATTCCACATGTCTGGAGCTGTTCAAG

TTCACCATCGGCATGGGTGACCTGGAGTTCACCGAGAACTATGACTTCAAGGCTGTCTTC

ATCATCCTGTTACTGGCCTATGTGATTCTCACCTACATCCTCCTGCTCAACATGCTCATT

GCTCTCATGGGCGAGACTGTCAACAAGATTGCACAAGAGAGCAAGAACATCTGGAAGCTG

CAGCGAGCCATCACCATCCTGGATACAGAGAAGAGTTTCCTGAAGTGCATGAGGAAGGCC

TTCCGCTCCGGCAAGCTGCTGCAGGTGGGGTTCACGCCGGACGGCAAGGATGACTTCCGG

TGGTGCTTCAGGGTGGATGAGGTGAACTGGACTACCTGGAACACCAACGTGGGCATCATC

AACGAGGACCCAGGCAACTGTGAGGGCGTCAAGCGCACCCTGAGCTTCTCCCTGCGGTCA

GGCCGAGTTTCAGGGAGAAACTGGAAGAACTTTGCCCTGGTTCCCCTTCTGAGGGACGCA

AGCACTCGAGATAGGCATAGCACCCAGCCGGAAGAAGTTCAGCTGAAGCACTATACGGGA

TCCCTTAAGCCAGAGGATGCTGAGGTCTTCAAGGATTCCATGGCCCCAGGGGAGAAATGA


***

16 июля 2019 г. в 14:03 Специалист Института белка:

Да, это то, что нужно. Спасибо!

***

16 июля 2019 г. в 19:23 Александр Кушелев: 

Здравствуйте, Специалист Института белка!

Высылаю Вам предварительные результаты обработки кодирующей нуклеотидной последовательности.

Папка Secondary_structure содержит схему вторичной структуры в компактном (compact) и в развёрнутом (full) представлении. 

 

compact

 

 

 

full

 

 

Словарь вторичных структур

А так же фрагмент схемы, который показался мне интересным:


С 72 по 91 аминокислотный остаток происходит плавное изменение частоты вибраций радикалов, что видно в крайнем правом столбце (ноты). Это может означать биологически активный участок белка. Возможно, что в этой зоне формируется канал, где радикалы аминокислот влияют на проходящие через канал ионы/молекулы (ускоряют, тормозят, фильтруют...)

На развернутой схеме вторичной структуры хорошо видны участки альфа-спиралей (красный цвет)

Наиболее протяженными являются Gln124 - Leu144 и Phe713 - Lys736

Есть только один виток бета-спирали Ser484 - Gly486 и нет ни одного витка пи-спирали.

3D структура может изгибаться на аминокислотных остатках Pro, которые отмечены желтым цветом, т.е. либо находятся на конце спирали, либо вообще не входят в состав спирали.

Остатки Met (отмечены сиреневым цветом) плавно изгибают альфа-310-спираль, что пока не может показать программа Пикотех 3D, Наличие Met и Pro не позволяет с помощью существующей верстии Picotech 3D построить пространственную структуру в автоматическом режиме. Однако, если у Вас есть программа редактор PDB-файлов, то с её помощью можно "уложить" 26 жестких фрагмента белка:  

1. 1-13

2. 15-25

3. 26-29

4. 30-33

5. 35-64

6. 65-74

7. 75-90

8. 91-109

9. 110-152

10. 153-244

11. 245-275

12. 276-322

13. 323-337

14. 338-361

15. 362-457

16. 458-463

17. 464-502

18. 503-609

19. 610-613

20. 615-624

21. 625-764

22. 765-795

23. 796-809

24. 810-824

25. 825-836

26. 837-839

в правильную пространственную модель. При этом жесткие участки нужно ещё подправить на всех Met, которые входят в состав спиралей.

Я уже подготовил алгоритм для автоматической укладки пространственной модели с учетом изгиба на пролинах, но мой программист пока не может назвать дату, когда будет готова новая верстия Picitech 3D. Поэтому эту задачу я бы мог попытаться решить вручную, но для этого мне нужен редактор PDB-файлов, в котором можно "гнуть" модель белка на произвольном аминокислотном остатке в произвольном направлении. Те редакторы, которые мне попадались, могут гнуть структуру только по тем направлениям, которые "считают нужными", а для пикотехнологических моделей такие ограничения не подходят.

Что мы видим в папке 3D_Structure?

Там находится PDB-файл с координатами предварительной модели, т.е. готовый для укладки 26 жестких участков белка в редакторе PDB-файлов в ручном режиме.

Кроме того, там можно посмотреть интересные жесткие фрагменты белка. 










Например, фрагмент Met1-Cys21 замкнут через дисульфидный мостик, который может образоваться не только между двумя цистеинами Cys-Cys, но и между цистеином и метионином Cys-Met и даже между двумя метионинами Met-Met. Есть как минимум ещё один участок Met61-Cys93, который предположительно замкнут через дисульфидный мостик.

Мне интересно узнать Ваше мнение о полученной схеме вторичной структуры и пространственных моделях 26 жестких участков.

Ещё хотелось бы спросить, в какой лаборатории могут проверить структуры двух полилизинов методом кругового дихроизма?

Вот схемы этих двух белков-полилизинов, полученные с помощью программы Пикотех 2D: 

 

Красным цветом показана прямая альфа-спираль KGO44433.1

Синим цветом показана прямая пи-спираль XM_022674627.1

Круговой дихроизм для альфа-спирального белка KGO44433.1 должен совпасть с графиком альфа-спирали, а для пи-спирального белка  XM_022674627.1 с графиком пи-спирали (бета-поворота).

Графики кругового дихроизма для полилизина: 

 

Подробнее в 685-ом выпуске рассылки "Новости лаборатории Наномир"

Копия архива рассылки с вырезанной рекламой и восстановленными картинками (Часть 2)

Часть 1 

Заранее благодарю за совет и жду вопросов, связанных со структурой белка AAS15574.1 Mus musculus (house mouse) TRPV1alpha

Ваш Александр Кушелев

***

17 июля 2019 г. в 8:17 Специалист Института белка:

Здравствуйте!

Спасибо большое за вашу работу!

На счет программ, то вот наш "рейтинг":

1) Бесплатный, но мощный - PyMOL.

2) Есть ещё VMD, но там больше уклон в визуализацию.

3) Может быть, что-то может HyperChem.

Но вручную эта задача решается ну так... Можно, конечно, попробовать

4) Есть ещё  FoldIt

На сколько я знаю, круговым дихроизмом занимаются в Красноярске (институт физики им. Киренского СО РАН), в МФТИ

***

17 июля 2019 г. в 12:33 Александр Кушелев:

Здравствуйте, Специалист Института белка! 

Благодарю за советы. Осталось узнать, можно ли в программе PyMOL или VMD поворачивать фрагменты белка вокруг произвольной оси, проходящей через произвольную точку? В программе HyperChem есть только разрешенные углы, которые не совпадают с нужными в пикотехнологических моделях. Поэтому в HyperChem мне не удаётся уложить пространственную модель. Если и в других программах не предусмотрена такая возможность.то есть ещё вариант распечатать жесткие участки на 3D принтере и сделать укладку вручную. Правда, PDB-файл вручную получить проблематично. Поэтому интересно было бы пообщаться со специалистами, которые знают возможности программ PyMOL или VMD.

Есть и ещё один путь. Найти программиста, который либо подправит существующую программу для укладки фрагментов, либо напишет новую версию программы "Пикотех 3D", которая позволит вручную и в автоматическом режиме проводить укладку. Оба алгоритма я уже разработал, но мой программист сумел написать Picotech 2D, а 3D существенно сложнее. Тот программист, которые её делал, ушёл на большую зарплату и недоступен. Может быть в Институте белка найдется программист, который решит эту проблему?

Существующая версия Picotech 3D написана в виде скрипта для 3DS Max. Язык похож на Си, но со спецификой. Вот почти последняя версия этой программы: http://nanoworld.narod.ru/EMBLReader023L_20101113.txt

Подробнее: http://nanoworld88.narod.ru/data/212.htm

Мне интересно услышать Ваши вопросы по вторичной структуре исследуемого Вами белка и обнаруженных особенностях, связанных с дисульфидными мостиками. Возможно, что у Вас есть и другие белки, структуры которых желательно определить.

Программа Picotech 2D позволяет получать вторичные структуры белков автоматически, причём целыми хромосомами.

Правильная вторичная структура может помочь разобраться в функционировании белка иногда даже лучше, чем неправильная пространственная.

РСА и другие методы обычно не позволяют отличить даже пи-спираль от альфа-спирали, поэтому все структуры в PDB очень условны. Иногда изображаются набором альфа-спиралей, хотя в реальности там либо пи-спирали, либо комбинация альфа-пи, либо вообще нет ни одной фундаментальной (альфа-310-бета-пи-спирали). Например, коллаген оказался не тройной спиралью, а программной спиралью, где повторяются коды n*(альфа-пи-пи-): http://nanoworld88.narod.ru/data/607_files/0_17aa9a.png

Подробнее: http://nanoworld88.narod.ru/data/607.htm

Программная спираль коллагена содержит примерно 9 аминокислотных остатков на один виток:

 

Копия на nanoworld.narod.ru


Подробнее: http://nanoworld88.narod.ru/data/607.htm

Поэтому создаётся впечатление, что это тройная спираль, т.к. каждый третий - пролин, а по кругу 9 аминокислотных остатков. Пролины действительно расположены примерно через 120 градусов. Но это не тройная, а одиночная спираль с ~9-ричной симметрией.

РСА кристаллов коллагена не дает четкой картины, поэтому исследователи и приняли ошибочно коллаген за тройную спираль.

В похожей структуре обнаружилась корреляция между тремя уровнями структуры:

 

Подробнее: http://nanoworld88.narod.ru/data/596.htm

Существующая версия Picotech 3D имеет сильную сторону в случае моделирования жестких участков без Met и Pro. Они ещё не смоделированы. А контроль пространственной структуры хорошо получается при наличии дисульфидных мостиков, как во фрагментах лизоцимов из разных организмов:

 

http://www.nanoworld.org.ru/data/01/data/images/slides/990709/1.gif



 https://disk.yandex.ru/i/470ar7VyvPEFog




Подробнее: http://nanoworld.org.ru/topic/2078/

Что касается моделирования рецепторов, то в 3DS Max можно показывать и динамику, как в случае интерлейкина-34 (с конкурса CASP):


Подробнее: http://nanoworld88.narod.ru/data/281.htm

Я так понял, что в Вашем случае 4 почти одинаковых субъединицы образуют некий механизм. Интересно посмотреть, как он работает в динамике. И почему он работает по-разному при разных температурах...

Тут есть над чем подумать...

С уважением,

Ваш А.Кушелев

***

17 июля 2019 г. в 17:18 Специалист Института белка:

Здравствуйте!

В нашем белке, как вы и говорили, фрагменты образуют ионный канал, пропускная способность которого должна зависеть от температуры. Это и обеспечивает терморегуляцию: при повышении температуры должна поменяться конформация, частота и амплитуда колебаний, это в свою очередь изменяет пропускную способность ионного канала, по изменению ионного тока мозг понимает, что меняется температура - такая рабочая гипотеза. Ну вот нам и надо определить как именно там все меняется. Это действительно очень интересно. И мы на полпути к успеху!

Программа PyMOL позволяет поворачивать фрагменты белка вокруг произвольной оси, проходящей через произвольную точку.

А другие белки нам не надо исследовать

***

17 июля 2019 г. в 21:59 Александр Кушелев:

Здравствуйте, Специалист Института белка!

Для построения пикотехнологической модели жестких фрагментов на уровне аминокислотных остатков, т.е. чтобы видеть конструкцию, не  вникая в тонкости электронной и атомной структуры, я написал совсем простой скрипт для 3DS Max:

angx=#(-24,180,60,-45,-45); angy=#(-10.89167,83,0,15,15); angz=#(92,120,60,110,110)

dx=#(2,1.5,1.6,2,2); dy=#(0.6,1,0.8,1,0.6); dz=#(-0.45,0,-0.6,-0.15,-0.45)

kk=#(1,1,4,1,1,4,1,4,4,1,4,1,4,1,4,1,1,1,4,1,1,4,1,1,4,4,3,3,4,1,4,1,1,1,1,1,4,1,1,3,1,1,1,1,1,4,1,1,1,4,1,1,1,1,1,1)

peptide=box length:1 width:1 height:1  position:[0,0,-.5] wirecolor:[250,250,250]; Converttomesh peptide

for k = 1 to 56 do(

element = Hedra family:1 scalep:100 scaleq:100 scaler:100 radius:1 pos:[0,0,0] p:0.4; Converttomesh element

attach peptide element; peptide.pivot = [0,0,0]; move peptide [dx[kk[k]],dy[kk[k]],dz[kk[k]]]

rotate peptide angx[kk[k]] [1,0,0]; rotate peptide angy[kk[k]] [0,1,0]; rotate peptide angz[kk[k]] [0,0,1])

Он строит такую же по форме модель, только не показывает атомы и электроны.


Для сравнения вверху - модель инсулина, построенная с помощью этого скрипта, а внизу - с помощью полновесной программы Picotech 3D, где кольцами показаны валентные электроны.

Калибровка обоих программ заключается в подборе углов с карт Рамачандрана: angx=#(-24,180,60,-45,-45); angy=#(-10.89167,83,0,15,15); angz=#(92,120,60,110,110)

Чтобы программа точнее строила жесткие участки белка, не хватает карты Рамачандрана второго порядка.

Фундаментальные спирали (альфа-, 310-, пи-, бета-) программа строит идеально. Но нужна калибровка углов при переходе от одной спирали к другой, например, сначала идёт длинный участок прямой альфа-спирали, а за ним длинный участок прямой пи-спирали.

Если найти или получить такие углы для всех 12 переходов, т.е.

альфа -> бета

альфа -> пи

альфа ->310

бета -> альфа

бета -> пи

бета -> 310

пи -> альф

пи -> бета

пи -> 310

310 -> альфа

310 -> бета

310 -> пи,

то 3D модель с точностью до аминокислотного остатка можно будет построить по трем таблицам, т.е.

по таблице 3D-генетического кода, по таблице композиционных углов (карте Рамачандрана) и таблице переходов фундаментальных спиралей.

Мне не хватает третьей таблицы.

Может быть Вам известны данные о белках, которые представляют собой уголок из двух участков разных фундаментальных спиралей?

Если такие данные добыть, то создание точной пространственной модели сильно упростится. При укладке нужно будет гнуть структуру вокруг единственной оси пролина.

С уважением,

Ваш А.Кушелев

***

18 июля 2019 г. в 7:40 Специалист Института белка:

Здравствуйте!

По данной теме о белках, которые представляют собой уголок из двух участков разных фундаментальных спиралей найдено несколько статей. Здесь наиболее полезая из них. Надеюсь, это то что нужно.

mbb302.pdf


***

19 июля 2019 г. в 10:54 Александр Кушелев:

Здравствуйте, Специалист Института белка!

 Я продолжаю анализировать структуру белка, который Вы изучаете.

 Фрагмент Met1-Cys21, который замыкается через дисульфидный мостик, содержит участок программной n*(альфа-пи-) спирали: https://a.radikal.ru/a31/1907/0e/137f5c796f1d.png

 

Подробнее в 710-ом выпуске рассылки 

Пролиновая подстройка Pro14-Pro15 позволяет замкнуть дисульфидный мостик даже в том случае, если атомы серы расположены на несколько ангстрем дальше друг от друга, чем это необходимо в дисульфидном мостике. В данном случае замыкание дисульфидного мостика означает, что вся пространственная структура от Met1 до Cys21 построена правильно. Дело в том, что вероятность случайного замыкания модели равна 1/4^20=10^12, т.к. на каждом аминокислотном остатке цепь поворачивает на один из 4 композиционных углов. Таким образом, вероятность случайного замыкания модели цикла из 21 аминокислотного остатка равна одной триллионной. А мы уже знаем, что нашлось шесть фрагментов лизоцимов из разных организмов, случайное замыкание моделей которых может произойти с вероятностью 10^-84. Таким образом, дисульфидные мостики позволяют фактически гарантировать правильность построения моделей на тех участках, которые замкнуты дисульфидными мостиками.

В данном случае мы можем констатировать и тот факт, что правильно построена модель программной n*(альфа-пи-) спирали. А это очень важно, т.к. программные спирали часто встречаются в структурах белков. Теперь можно посмотреть, не встречается ли эта программная спираль в белке, который Вы изучаете ещё?

Встречается! Например, участок 26-30. При этом она непосредственно переходит в альфа-спираль, а значит правильно построена модель участка 26-34. Смотрим дальше, точнее вернёмся к циклу Met1-Cys21. В нём есть переход альфа-бета- и сразу за ним бета-альфа-. Раз модель цикла замкнулась через дисульфидный мостик, значит переход альфа-бета- бета-альфа- тоже моделируются правильно. Осталось проверить переходы бета-пи- и пи-бета-, а так же переходы альфа-310- и 310-альфа-. Если они тоже строятся правильно, то все жесткие участки, в состав которых не входят Met и Pro, построены правильно.

Пока можно сказать, что участки

35-69

70-90

91-97

98-108

109-130

138-144

144-154

154-159

160-166

170-176

188-205

смоделированы правильно.

Далее смотрим наиболее протяженные участки, смоделированные правильно:

424-450

547-577

Возможно, что с помощью циклов лизоцимов удастся проверить и другие переходы. Сегодня я попробую это сделать.

Ваш взгляд со стороны и советы мне могут очень помочь. Вы, вероятно, в курсе, что я по образованию инженер, поэтому в молекулярной биологии не профессионал :)

С уважением,

Ваш А.Кушелев

***

19 июля 2019 г. в 11:52 Александр Кушелев:

Здравствуйте, Специалист Института белка!

В программе Пикотех 3D мне удалось обнаружить ошибку, которая проявляется при определенных условиях. Она может компенсироваться, если число аминокислотных остатков одно, и может не компенсироваться, если другое. Поэтому одни фрагменты лизоцимов программа строит правильно, а другие неправильно. Поэтому до исправления этой ошибки нельзя гарантировать, что правильно будет построен переход альфа-пи-. и пи-альфа-. При разных длинах участков спиралей ошибка сказывается в разной степени. Так что пока надежными данными являются только данные Пикотех-2D и данные Пикотех-3D, подтвержденные, например, наличием дисульфидных мостиков.

С уважением,

Ваш А.Кушелев

***

19 июля 2019 г. в 11:55 Александр Кушелев: 

Здравствуйте, Специалист Института белка!

Для окончательной проверки программы Пикотех 3D могут помочь статьи с идентификаторами в PubMed 23524291, 1540655, 11902797. В них же может содержаться информация и для калибровки.

В этих статьях есть материал по структурам полилизина, которые кодируются разными триплетами: 

 

Красным цветом показана прямая альфа-спираль KGO44433.1

Синим цветом показана прямая пи-спираль XM_022674627.1

Я хочу обратиться в лаборатории Института физики им. Киренского СО РАН (Кросноярск), и в МФТИ с просьбой определить тип спирали этих белков, но может быть эта задача уже частично решена и описана в этих статьях? Вы можете получить эти статьи?

С уважением,

Ваш А.Кушелев

***

19 июля 2019 г. в 16:46 Специалист Института белка:

Статьи по полилизину

***

19 июля 2019 г. в 19:32 Александр Кушелев:

Здравствуйте, Специалист Института белка!

 Во статье: chittchang2002

Poly(L-lysine) as a model drug macromolecule with

which to investigate secondary structure and

membrane transport, part I : physicochemical and

stability studies

Montakarn Chittchang, Hemant H. Alur, Ashim K. Mitra

and Thomas P. Johnston

написано:

Polypeptides and proteins in solutions exhibit diOEerent

secondary structures such as random coil, a -helix

and b -sheet. These secondary structures are in a dynamic

equilibrium and the proportions of each conformer

depend on the solution microenvironment.

Цитата: "Эти вторичные структуры находятся в динамическом равновесие и пропорции каждого конформера зависит от решения микроокружения"

Конец цитаты.

Это может означать, что исходный PLL - вообще смесь разных белков-полилизинов.

А "в среднем по больнице температура нормальная" :)

***

19 июля 2019 г. в 23:08 Александр Кушелев:

Order.rar

Здравствуйте, Специалист Института белка!

В исследуемом Вами белке я вижу 5 участков программных спиралей, которые могут быть интересны своей регулярной структурой.

Нуклеотидные последовательности этих участков в формате fasta:

AAS15574_fragment_His817-Asp826.fasta

>ENA|AAS15574_fragment_His817-Asp826

cactatacgggatcccttaagccagaggat

Конец файла.

AAS15574_fragment_Phe713-Lys736.fasta

>ENA|AAS15574_fragment_Phe713-Lys736

ttcctgaagtgcatgaggaaggccttccgctccggcaagctgctgcaggtggggttcacgccggacggcaag

Конец файла.

AAS15574_fragment_Pro462-Phe474.fasta

>ENA|AAS15574_fragment_Pro462-Phe474

cccccctataagctgaataacaccgttggggactatttc

Конец файла.

AAS15574_fragment_Ser386-Asn394.fasta

>ENA|AAS15574_fragment_Ser386-Asn394

tcctgcattgacacctgtgagaagaat

Конец файла.

AAS15574_fragment_Ser593-Leu599.fasta

>ENA|AAS15574_fragment_Ser593-Leu599

tccacagccgtagtgacactg

Конец файла.

Вкладываю архив с 2D и 3D структурами этих участков.

В компактной форме:






В развёрнутом виде:






Файлы с координатами атомов в стандарте PDB:

AAS15574_fragment_His817-Asp826.pdb

PFRMAT TS

TARGET R00xx

AUTHOR 

REMARK Predictor remarks.

REMARK http://nanoworld.narod.ru

REMARK

REMARK Target sequence (10 acids)

REMARK HYTGSLKPED

REMARK

METHOD Method description

METHOD The strong correlation dependence of spatial structure

METHOD of the protein from its nucleotide sequence was

METHOD theoretically predicted by physical modelling,

METHOD experimentally  discovered and statistically confirmed.

METHOD In the process of biosynthesis the third nucleotide of

METHOD the codon controls the orientation of the amino acid

METHOD forming the concrete spatial isomer that is the

METHOD conformation of the protein molecule cutting off

METHOD competition ways of the forming of 2D and 3D structures.

METHOD On this base the computer program "Pikotechnology" for

METHOD the prediction of 2D structure of the proteins on their

METHOD nucleotide sequence was created.

MODEL 1

PARENT N/A 1

ATOM      1  N   HIS A   1      14.395   4.343 -10.412  1.00  0.50      A   

ATOM      2  CA  HIS A   1      15.184   3.088  -9.389  1.00  0.50      A   

ATOM      3  C   HIS A   1      14.482   1.351  -9.254  1.00  0.50      A   

ATOM      4  O   HIS A   1      14.646   0.132  -9.598  1.00  0.50      A   

ATOM      5  CB  HIS A   1      16.533   2.867 -10.331  1.00  0.50      A   

ATOM      6  CG  HIS A   1      17.395   2.228 -11.028  1.00  0.50      A   

ATOM      7  ND1 HIS A   1      18.259   1.600 -11.724  1.00  0.50      A   

ATOM      8  CD2 HIS A   1      17.623   0.510 -11.510  1.00  0.50      A   

ATOM      9  NE2 HIS A   1      16.765   1.143 -10.816  1.00  0.50      A   

ATOM     10  CE1 HIS A   1      15.904   1.782 -10.119  1.00  0.50      A   

ATOM     11  N   TYR A   2      12.361   2.466  -8.124  1.00  0.50      A   

ATOM     12  CA  TYR A   2      13.517   1.086  -8.166  1.00  0.50      A   

ATOM     13  C   TYR A   2      13.221  -0.469  -7.157  1.00  0.50      A   

ATOM     14  O   TYR A   2      12.881  -1.699  -7.214  1.00  0.50      A   

ATOM     15  CB  TYR A   2      13.052  -0.037  -9.477  1.00  0.50      A   

ATOM     16  CD2 TYR A   2      13.891  -0.716 -11.043  1.00  0.50      A   

ATOM     17  CE2 TYR A   2      14.453  -1.154 -12.099  1.00  0.50      A   

ATOM     18  CZ  TYR A   2      15.637  -0.771 -12.397  1.00  0.50      A   

ATOM     19  CE1 TYR A   2      16.249   0.053 -11.644  1.00  0.50      A   

ATOM     20  CD1 TYR A   2      15.686   0.491 -10.587  1.00  0.50      A   

ATOM     21  CG  TYR A   2      14.503   0.111 -10.285  1.00  0.50      A   

ATOM     22  OH  TYR A   2      17.089  -0.619 -13.212  1.00  0.50      A   

ATOM     23  N   THR A   3      13.656   0.499  -6.275  1.00  0.50      A   

ATOM     24  CA  THR A   3      13.616   0.039  -4.534  1.00  0.50      A   

ATOM     25  C   THR A   3      12.009  -0.426  -3.682  1.00  0.50      A   

ATOM     26  O   THR A   3      11.326  -1.394  -3.202  1.00  0.50      A   

ATOM     27  CB  THR A   3      14.057  -1.680  -4.485  1.00  0.50      A   

ATOM     28  OG1 THR A   3      15.568  -1.704  -3.571  1.00  0.50      A   

ATOM     29  CG2 THR A   3      12.859  -2.835  -3.726  1.00  0.50      A   

ATOM     30  N   GLY A   4      11.022   0.719  -2.983  1.00  0.50      A   

ATOM     31  CA  GLY A   4      11.452   1.995  -4.178  1.00  0.50      A   

ATOM     32  C   GLY A   4      10.166   2.721  -5.340  1.00  0.50      A   

ATOM     33  O   GLY A   4       9.453   3.750  -5.592  1.00  0.50      A   

ATOM     34  N   SER A   5      10.600   1.574  -5.990  1.00  0.50      A   

ATOM     35  CA  SER A   5       9.376   0.803  -7.063  1.00  0.50      A   

ATOM     36  C   SER A   5       7.546   0.831  -6.638  1.00  0.50      A   

ATOM     37  O   SER A   5       6.415   1.344  -6.936  1.00  0.50      A   

ATOM     38  CB  SER A   5       8.806   1.997  -8.267  1.00  0.50      A   

ATOM     39  OG  SER A   5       9.159   1.359  -9.873  1.00  0.50      A   

ATOM     40  N   LEU A   6       8.177  -0.632  -4.522  1.00  0.50      A   

ATOM     41  CA  LEU A   6       7.009  -0.300  -5.852  1.00  0.50      A   

ATOM     42  C   LEU A   6       5.320  -1.121  -5.900  1.00  0.50      A   

ATOM     43  O   LEU A   6       4.068  -0.936  -5.737  1.00  0.50      A   

ATOM     44  CB  LEU A   6       5.984   1.095  -5.407  1.00  0.50      A   

ATOM     45  CG  LEU A   6       6.208   2.345  -6.632  1.00  0.50      A   

ATOM     46  CD1 LEU A   6       4.640   2.695  -7.392  1.00  0.50      A   

ATOM     47  CD2 LEU A   6       6.847   3.813  -5.790  1.00  0.50      A   

ATOM     48  N   LYS A   7       6.164  -2.048  -6.496  1.00  0.50      A   

ATOM     49  CA  LYS A   7       5.656  -3.765  -6.308  1.00  0.50      A   

ATOM     50  C   LYS A   7       4.791  -4.365  -4.752  1.00  0.50      A   

ATOM     51  O   LYS A   7       3.674  -4.742  -4.260  1.00  0.50      A   

ATOM     52  CB  LYS A   7       3.997  -3.966  -6.945  1.00  0.50      A   

ATOM     53  CG  LYS A   7       3.610  -4.957  -8.259  1.00  0.50      A   

ATOM     54  CD  LYS A   7       4.774  -5.795  -9.160  1.00  0.50      A   

ATOM     55  CE  LYS A   7       6.432  -5.731  -8.828  1.00  0.50      A   

ATOM     56  NZ  LYS A   7       7.093  -4.818  -7.568  1.00  0.50      A   

ATOM     57  N   PRO A   8       5.645  -4.897  -3.423  1.00  0.50      A   

ATOM     58  CA  PRO A   8       7.022  -3.772  -3.705  1.00  0.50      A   

ATOM     59  C   PRO A   8       7.452  -2.423  -2.471  1.00  0.50      A   

ATOM     60  O   PRO A   8       8.286  -2.057  -1.576  1.00  0.50      A   

ATOM     61  CB  PRO A   8       8.256  -4.845  -3.453  1.00  0.50      A   

ATOM     62  CG  PRO A   8       8.017  -5.639  -3.114  1.00  0.50      A   

ATOM     63  CD  PRO A   8       7.052  -6.121  -3.135  1.00  0.50      A   

ATOM     64  N   GLU A   9       6.463  -1.855  -3.262  1.00  0.50      A   

ATOM     65  CA  GLU A   9       5.453  -0.613  -2.437  1.00  0.50      A   

ATOM     66  C   GLU A   9       5.027  -0.753  -0.613  1.00  0.50      A   

ATOM     67  O   GLU A   9       5.262  -0.282   0.550  1.00  0.50      A   

ATOM     68  CB  GLU A   9       6.510   0.671  -1.782  1.00  0.50      A   

ATOM     69  CG  GLU A   9       5.895   2.182  -2.472  1.00  0.50      A   

ATOM     70  CD  GLU A   9       5.652   2.744  -0.697  1.00  0.50      A   

ATOM     71  OE1 GLU A   9       5.663   2.377   0.520  1.00  0.50      A   

ATOM     72  OE2 GLU A   9       5.381   4.207  -1.858  1.00  0.50      A   

ATOM     73  N   ASP A  10       3.695  -2.951  -1.255  1.00  0.50      A   

ATOM     74  CA  ASP A  10       3.776  -1.456  -0.255  1.00  0.50      A   

ATOM     75  C   ASP A  10       2.575  -1.156   1.157  1.00  0.50      A   

ATOM     76  O   ASP A  10       2.448  -1.125   2.427  1.00  0.50      A   

ATOM     77  CB  ASP A  10       4.872  -1.729   1.140  1.00  0.50      A   

ATOM     78  CG  ASP A  10       5.767  -0.299   0.313  1.00  0.50      A   

ATOM     79  OD1 ASP A  10       5.744   0.512  -0.671  1.00  0.50      A   

ATOM     80  OD2 ASP A  10       6.714  -0.816   1.858  1.00  0.50      A   

TER

END

AAS15574_fragment_Phe713-Lys736.pdb

ATOM      1  N   PHE A   1       7.590   1.900 -18.107  1.00  0.50      A   

ATOM      2  CA  PHE A   1       7.389   3.588 -17.514  1.00  0.50      A   

ATOM      3  C   PHE A   1       6.096   4.024 -16.222  1.00  0.50      A   

ATOM      4  O   PHE A   1       5.912   4.346 -15.000  1.00  0.50      A   

ATOM      5  CB  PHE A   1       8.453   3.851 -16.100  1.00  0.50      A   

ATOM      6  CG  PHE A   1       9.876   5.040 -15.676  1.00  0.50      A   

ATOM      7  CD1 PHE A   1      10.839   5.829 -15.406  1.00  0.50      A   

ATOM      8  CE1 PHE A   1      11.225   6.686 -16.274  1.00  0.50      A   

ATOM      9  CZ  PHE A   1      10.654   6.742 -17.411  1.00  0.50      A   

ATOM     10  CE2 PHE A   1       9.691   5.954 -17.682  1.00  0.50      A   

ATOM     11  CD2 PHE A   1       9.301   5.096 -16.817  1.00  0.50      A   

ATOM     12  N   LEU A   2       5.424   3.847 -17.415  1.00  0.50      A   

ATOM     13  CA  LEU A   2       3.627   3.900 -17.307  1.00  0.50      A   

ATOM     14  C   LEU A   2       2.673   2.674 -16.251  1.00  0.50      A   

ATOM     15  O   LEU A   2       2.006   2.526 -15.173  1.00  0.50      A   

ATOM     16  CB  LEU A   2       3.144   4.974 -15.961  1.00  0.50      A   

ATOM     17  CG  LEU A   2       2.150   6.269 -16.630  1.00  0.50      A   

ATOM     18  CD1 LEU A   2       0.549   6.222 -15.861  1.00  0.50      A   

ATOM     19  CD2 LEU A   2       2.985   7.831 -16.263  1.00  0.50      A   

ATOM     20  N   LYS A   3       2.860   2.009 -17.456  1.00  0.50      A   

ATOM     21  CA  LYS A   3       2.940   0.215 -17.326  1.00  0.50      A   

ATOM     22  C   LYS A   3       3.706  -0.624 -15.831  1.00  0.50      A   

ATOM     23  O   LYS A   3       3.458  -1.287 -14.768  1.00  0.50      A   

ATOM     24  CB  LYS A   3       1.458  -0.389 -16.530  1.00  0.50      A   

ATOM     25  CG  LYS A   3       0.341  -1.414 -17.280  1.00  0.50      A   

ATOM     26  CD  LYS A   3       0.474  -1.902 -18.896  1.00  0.50      A   

ATOM     27  CE  LYS A   3       1.738  -1.423 -19.913  1.00  0.50      A   

ATOM     28  NZ  LYS A   3       2.992  -0.401 -19.418  1.00  0.50      A   

ATOM     29  N   CYS A   4       4.788  -0.356 -16.659  1.00  0.50      A   

ATOM     30  CA  CYS A   4       6.351  -0.097 -15.803  1.00  0.50      A   

ATOM     31  C   CYS A   4       6.419   0.729 -14.117  1.00  0.50      A   

ATOM     32  O   CYS A   4       6.603   0.535 -12.869  1.00  0.50      A   

ATOM     33  CB  CYS A   4       6.713  -1.522 -14.784  1.00  0.50      A   

ATOM     34  SG  CYS A   4       8.256  -2.192 -15.316  1.00  0.50      A   

ATOM     35  N   MET A   5       6.414   1.788 -15.014  1.00  0.50      A   

ATOM     36  CA  MET A   5       5.675   3.307 -14.388  1.00  0.50      A   

ATOM     37  C   MET A   5       4.223   3.269 -13.196  1.00  0.50      A   

ATOM     38  O   MET A   5       3.864   3.456 -11.985  1.00  0.50      A   

ATOM     39  CB  MET A   5       6.692   3.804 -13.020  1.00  0.50      A   

ATOM     40  CG  MET A   5       5.858   3.950 -11.473  1.00  0.50      A   

ATOM     41  SD  MET A   5       6.206   4.406  -9.670  1.00  0.50      A   

ATOM     42  CE  MET A   5       4.352   3.969  -9.967  1.00  0.50      A   

ATOM     43  N   ARG A   6       3.634   3.170 -14.450  1.00  0.50      A   

ATOM     44  CA  ARG A   6       2.073   2.274 -14.484  1.00  0.50      A   

ATOM     45  C   ARG A   6       1.754   0.818 -13.341  1.00  0.50      A   

ATOM     46  O   ARG A   6       1.119   0.427 -12.305  1.00  0.50      A   

ATOM     47  CB  ARG A   6       0.927   3.035 -13.341  1.00  0.50      A   

ATOM     48  CG  ARG A   6      -0.530   3.751 -13.811  1.00  0.50      A   

ATOM     49  CD  ARG A   6      -1.011   3.895 -15.429  1.00  0.50      A   

ATOM     50  NE  ARG A   6       0.418   3.049 -16.647  1.00  0.50      A   

ATOM     51  CZ  ARG A   6       0.332   4.771 -17.385  1.00  0.50      A   

ATOM     52  NH1 ARG A   6      -0.188   5.931 -17.268  1.00  0.50      A   

ATOM     53  NH2 ARG A   6       1.501   3.716 -18.412  1.00  0.50      A   

ATOM     54  N   LYS A   7       2.419   0.259 -14.424  1.00  0.50      A   

ATOM     55  CA  LYS A   7       3.395  -1.204 -14.039  1.00  0.50      A   

ATOM     56  C   LYS A   7       4.272  -1.389 -12.388  1.00  0.50      A   

ATOM     57  O   LYS A   7       4.259  -1.996 -11.264  1.00  0.50      A   

ATOM     58  CB  LYS A   7       2.345  -2.435 -13.278  1.00  0.50      A   

ATOM     59  CG  LYS A   7       2.032  -3.951 -13.958  1.00  0.50      A   

ATOM     60  CD  LYS A   7       2.616  -4.423 -15.477  1.00  0.50      A   

ATOM     61  CE  LYS A   7       3.577  -3.431 -16.453  1.00  0.50      A   

ATOM     62  NZ  LYS A   7       4.043  -1.865 -16.015  1.00  0.50      A   

ATOM     63  N   ALA A   8       5.161  -0.658 -13.163  1.00  0.50      A   

ATOM     64  CA  ALA A   8       6.233   0.454 -12.238  1.00  0.50      A   

ATOM     65  C   ALA A   8       5.634   1.324 -10.684  1.00  0.50      A   

ATOM     66  O   ALA A   8       5.719   1.357  -9.410  1.00  0.50      A   

ATOM     67  CB  ALA A   8       7.135  -0.476 -11.006  1.00  0.50      A   

ATOM     68  N   PHE A   9       5.206   2.145 -11.718  1.00  0.50      A   

ATOM     69  CA  PHE A   9       3.712   3.088 -11.366  1.00  0.50      A   

ATOM     70  C   PHE A   9       2.340   2.384 -10.293  1.00  0.50      A   

ATOM     71  O   PHE A   9       1.775   2.450  -9.150  1.00  0.50      A   

ATOM     72  CB  PHE A   9       3.959   4.062  -9.887  1.00  0.50      A   

ATOM     73  CG  PHE A   9       3.907   5.915  -9.460  1.00  0.50      A   

ATOM     74  CD1 PHE A   9       3.887   7.159  -9.184  1.00  0.50      A   

ATOM     75  CE1 PHE A   9       3.638   8.012 -10.104  1.00  0.50      A   

ATOM     76  CZ  PHE A   9       3.421   7.619 -11.296  1.00  0.50      A   

ATOM     77  CE2 PHE A   9       3.441   6.375 -11.572  1.00  0.50      A   

ATOM     78  CD2 PHE A   9       3.688   5.518 -10.655  1.00  0.50      A   

ATOM     79  N   ARG A  10       2.065   1.889 -11.560  1.00  0.50      A   

ATOM     80  CA  ARG A  10       1.211   0.304 -11.585  1.00  0.50      A   

ATOM     81  C   ARG A  10       1.537  -1.003 -10.276  1.00  0.50      A   

ATOM     82  O   ARG A  10       1.059  -1.586  -9.246  1.00  0.50      A   

ATOM     83  CB  ARG A  10      -0.306   0.433 -10.648  1.00  0.50      A   

ATOM     84  CG  ARG A  10      -1.844   0.230 -11.320  1.00  0.50      A   

ATOM     85  CD  ARG A  10      -2.104  -0.030 -12.974  1.00  0.50      A   

ATOM     86  NE  ARG A  10      -0.291  -0.087 -13.951  1.00  0.50      A   

ATOM     87  CZ  ARG A  10      -0.937  -1.847 -14.156  1.00  0.50      A   

ATOM     88  NH1 ARG A  10      -1.883  -2.650 -13.864  1.00  0.50      A   

ATOM     89  NH2 ARG A  10       0.700  -1.675 -15.070  1.00  0.50      A   

ATOM     90  N   SER A  11       2.535  -1.210 -11.218  1.00  0.50      A   

ATOM     91  CA  SER A  11       4.063  -1.901 -10.561  1.00  0.50      A   

ATOM     92  C   SER A  11       4.675  -1.463  -8.840  1.00  0.50      A   

ATOM     93  O   SER A  11       4.823  -1.893  -7.646  1.00  0.50      A   

ATOM     94  CB  SER A  11       3.706  -3.436  -9.716  1.00  0.50      A   

ATOM     95  OG  SER A  11       4.632  -4.716 -10.501  1.00  0.50      A   

ATOM     96  N   GLY A  12       5.156  -0.436  -9.641  1.00  0.50      A   

ATOM     97  CA  GLY A  12       5.362   1.144  -8.803  1.00  0.50      A   

ATOM     98  C   GLY A  12       4.194   1.686  -7.435  1.00  0.50      A   

ATOM     99  O   GLY A  12       4.075   1.861  -6.176  1.00  0.50      A   

ATOM    100  N   LYS A  13       3.549   2.072  -8.603  1.00  0.50      A   

ATOM    101  CA  LYS A  13       1.752   2.107  -8.498  1.00  0.50      A   

ATOM    102  C   LYS A  13       0.808   0.873  -7.442  1.00  0.50      A   

ATOM    103  O   LYS A  13       0.140   0.721  -6.364  1.00  0.50      A   

ATOM    104  CB  LYS A  13       1.256   3.179  -7.156  1.00  0.50      A   

ATOM    105  CG  LYS A  13       0.353   4.593  -7.368  1.00  0.50      A   

ATOM    106  CD  LYS A  13      -0.099   5.181  -8.891  1.00  0.50      A   

ATOM    107  CE  LYS A  13       0.295   4.408 -10.343  1.00  0.50      A   

ATOM    108  NZ  LYS A  13       1.190   2.976 -10.419  1.00  0.50      A   

ATOM    109  N   LEU A  14       1.214   0.198  -8.576  1.00  0.50      A   

ATOM    110  CA  LEU A  14       0.892  -1.573  -8.580  1.00  0.50      A   

ATOM    111  C   LEU A  14       1.641  -2.707  -7.282  1.00  0.50      A   

ATOM    112  O   LEU A  14       1.396  -3.402  -6.240  1.00  0.50      A   

ATOM    113  CB  LEU A  14      -0.564  -1.914  -7.601  1.00  0.50      A   

ATOM    114  CG  LEU A  14      -1.747  -2.703  -8.646  1.00  0.50      A   

ATOM    115  CD1 LEU A  14      -2.129  -4.305  -7.976  1.00  0.50      A   

ATOM    116  CD2 LEU A  14      -3.222  -1.658  -8.672  1.00  0.50      A   

ATOM    117  N   LEU A  15       2.652  -2.396  -8.171  1.00  0.50      A   

ATOM    118  CA  LEU A  15       4.292  -2.986  -7.717  1.00  0.50      A   

ATOM    119  C   LEU A  15       5.124  -2.434  -6.126  1.00  0.50      A   

ATOM    120  O   LEU A  15       5.466  -2.795  -4.950  1.00  0.50      A   

ATOM    121  CB  LEU A  15       4.139  -4.489  -6.761  1.00  0.50      A   

ATOM    122  CG  LEU A  15       5.004  -5.767  -7.617  1.00  0.50      A   

ATOM    123  CD1 LEU A  15       6.289  -6.398  -6.563  1.00  0.50      A   

ATOM    124  CD2 LEU A  15       3.803  -7.064  -7.999  1.00  0.50      A   

ATOM    125  N   GLN A  16       5.432  -1.430  -7.034  1.00  0.50      A   

ATOM    126  CA  GLN A  16       5.678   0.198  -6.307  1.00  0.50      A   

ATOM    127  C   GLN A  16       4.696   0.759  -4.807  1.00  0.50      A   

ATOM    128  O   GLN A  16       4.753   0.993  -3.553  1.00  0.50      A   

ATOM    129  CB  GLN A  16       6.956   0.105  -5.059  1.00  0.50      A   

ATOM    130  CG  GLN A  16       8.159   1.316  -5.529  1.00  0.50      A   

ATOM    131  CD  GLN A  16       7.848   2.090  -3.847  1.00  0.50      A   

ATOM    132  OE1 GLN A  16       7.104   2.073  -2.815  1.00  0.50      A   

ATOM    133  NE2 GLN A  16       9.342   2.918  -4.649  1.00  0.50      A   

ATOM    134  N   VAL A  17       3.844   0.836  -5.891  1.00  0.50      A   

ATOM    135  CA  VAL A  17       2.132   1.239  -5.506  1.00  0.50      A   

ATOM    136  C   VAL A  17       1.092   0.134  -4.399  1.00  0.50      A   

ATOM    137  O   VAL A  17       0.562   0.020  -3.242  1.00  0.50      A   

ATOM    138  CB  VAL A  17       2.205   2.396  -4.161  1.00  0.50      A   

ATOM    139  CG1 VAL A  17       1.500   3.871  -4.831  1.00  0.50      A   

ATOM    140  CG2 VAL A  17       1.337   1.946  -2.615  1.00  0.50      A   

ATOM    141  N   GLY A  18       1.177  -0.496  -5.624  1.00  0.50      A   

ATOM    142  CA  GLY A  18       0.471  -2.151  -5.695  1.00  0.50      A   

ATOM    143  C   GLY A  18       1.120  -3.540  -4.608  1.00  0.50      A   

ATOM    144  O   GLY A  18       0.871  -4.267  -3.588  1.00  0.50      A   

ATOM    145  N   PHE A  19       1.964  -3.550  -5.710  1.00  0.50      A   

ATOM    146  CA  PHE A  19       3.633  -4.139  -5.380  1.00  0.50      A   

ATOM    147  C   PHE A  19       4.480  -3.809  -3.735  1.00  0.50      A   

ATOM    148  O   PHE A  19       4.860  -4.335  -2.636  1.00  0.50      A   

ATOM    149  CB  PHE A  19       3.555  -5.778  -4.667  1.00  0.50      A   

ATOM    150  CG  PHE A  19       4.224  -7.495  -5.139  1.00  0.50      A   

ATOM    151  CD1 PHE A  19       4.662  -8.645  -5.469  1.00  0.50      A   

ATOM    152  CE1 PHE A  19       5.337  -8.785  -6.546  1.00  0.50      A   

ATOM    153  CZ  PHE A  19       5.562  -7.778  -7.293  1.00  0.50      A   

ATOM    154  CE2 PHE A  19       5.124  -6.628  -6.963  1.00  0.50      A   

ATOM    155  CD2 PHE A  19       4.450  -6.482  -5.886  1.00  0.50      A   

ATOM    156  N   THR A  20       4.516  -2.626  -4.446  1.00  0.50      A   

ATOM    157  CA  THR A  20       5.150  -1.200  -3.547  1.00  0.50      A   

ATOM    158  C   THR A  20       4.311  -0.576  -1.986  1.00  0.50      A   

ATOM    159  O   THR A  20       4.401  -0.501  -0.714  1.00  0.50      A   

ATOM    160  CB  THR A  20       6.449  -1.827  -2.512  1.00  0.50      A   

ATOM    161  OG1 THR A  20       7.898  -1.013  -3.109  1.00  0.50      A   

ATOM    162  CG2 THR A  20       6.292  -1.562  -0.709  1.00  0.50      A   

ATOM    163  N   PRO A  21       3.528  -0.169  -3.048  1.00  0.50      A   

ATOM    164  CA  PRO A  21       1.965   0.607  -2.606  1.00  0.50      A   

ATOM    165  C   PRO A  21       0.659  -0.313  -1.619  1.00  0.50      A   

ATOM    166  O   PRO A  21       0.095  -0.414  -0.477  1.00  0.50      A   

ATOM    167  CB  PRO A  21       2.541   1.664  -1.472  1.00  0.50      A   

ATOM    168  CG  PRO A  21       3.393   1.542  -1.225  1.00  0.50      A   

ATOM    169  CD  PRO A  21       4.185   1.036  -1.755  1.00  0.50      A   

ATOM    170  N   ASP A  22       0.419  -0.692  -2.932  1.00  0.50      A   

ATOM    171  CA  ASP A  22      -0.304  -2.330  -3.127  1.00  0.50      A   

ATOM    172  C   ASP A  22       0.130  -3.737  -1.962  1.00  0.50      A   

ATOM    173  O   ASP A  22      -0.293  -4.463  -1.000  1.00  0.50      A   

ATOM    174  CB  ASP A  22      -1.828  -2.426  -2.183  1.00  0.50      A   

ATOM    175  CG  ASP A  22      -2.502  -2.769  -3.902  1.00  0.50      A   

ATOM    176  OD1 ASP A  22      -2.193  -2.897  -5.135  1.00  0.50      A   

ATOM    177  OD2 ASP A  22      -3.917  -2.810  -2.660  1.00  0.50      A   

ATOM    178  N   GLY A  23       1.139  -3.764  -2.916  1.00  0.50      A   

ATOM    179  CA  GLY A  23       2.720  -4.395  -2.329  1.00  0.50      A   

ATOM    180  C   GLY A  23       3.302  -4.092  -0.568  1.00  0.50      A   

ATOM    181  O   GLY A  23       3.489  -4.631   0.573  1.00  0.50      A   

ATOM    182  N   LYS A  24       3.695  -2.951  -1.255  1.00  0.50      A   

ATOM    183  CA  LYS A  24       3.776  -1.456  -0.255  1.00  0.50      A   

ATOM    184  C   LYS A  24       2.575  -1.156   1.157  1.00  0.50      A   

ATOM    185  O   LYS A  24       2.448  -1.125   2.427  1.00  0.50      A   

ATOM    186  CB  LYS A  24       4.871  -1.729   1.132  1.00  0.50      A   

ATOM    187  CG  LYS A  24       6.305  -0.868   1.380  1.00  0.50      A   

ATOM    188  CD  LYS A  24       6.893   0.283   0.286  1.00  0.50      A   

ATOM    189  CE  LYS A  24       6.100   0.692  -1.150  1.00  0.50      A   

ATOM    190  NZ  LYS A  24       4.645  -0.014  -1.643  1.00  0.50      A   

TER

END

AAS15574_fragment_Pro462-Phe474.pdb

ATOM      1  N   PRO A   1      -2.026   0.671  -6.925  1.00  0.50      A   

ATOM      2  CA  PRO A   1      -2.701  -0.151  -8.378  1.00  0.50      A   

ATOM      3  C   PRO A   1      -2.201  -1.905  -8.829  1.00  0.50      A   

ATOM      4  O   PRO A   1      -2.586  -3.122  -8.860  1.00  0.50      A   

ATOM      5  CB  PRO A   1      -4.239  -0.388  -7.819  1.00  0.50      A   

ATOM      6  CG  PRO A   1      -4.367  -0.217  -6.949  1.00  0.50      A   

ATOM      7  CD  PRO A   1      -3.781   0.401  -6.288  1.00  0.50      A   

ATOM      8  N   PRO A   2      -1.209  -1.115  -9.393  1.00  0.50      A   

ATOM      9  CA  PRO A   2       0.400  -1.909  -9.535  1.00  0.50      A   

ATOM     10  C   PRO A   2       1.002  -3.140  -8.250  1.00  0.50      A   

ATOM     11  O   PRO A   2       1.225  -4.375  -8.015  1.00  0.50      A   

ATOM     12  CB  PRO A   2       0.057  -2.911 -10.805  1.00  0.50      A   

ATOM     13  CG  PRO A   2      -0.806  -2.961 -11.038  1.00  0.50      A   

ATOM     14  CD  PRO A   2      -1.601  -2.258 -10.842  1.00  0.50      A   

ATOM     15  N   TYR A   3       0.957  -1.125  -6.529  1.00  0.50      A   

ATOM     16  CA  TYR A   3       1.787  -2.613  -7.113  1.00  0.50      A   

ATOM     17  C   TYR A   3       3.198  -3.390  -6.146  1.00  0.50      A   

ATOM     18  O   TYR A   3       3.534  -4.372  -5.403  1.00  0.50      A   

ATOM     19  CB  TYR A   3       0.949  -4.053  -6.464  1.00  0.50      A   

ATOM     20  CD2 TYR A   3       0.080  -5.570  -7.215  1.00  0.50      A   

ATOM     21  CE2 TYR A   3      -0.514  -6.574  -7.725  1.00  0.50      A   

ATOM     22  CZ  TYR A   3      -0.590  -6.692  -8.996  1.00  0.50      A   

ATOM     23  CE1 TYR A   3      -0.083  -5.800  -9.751  1.00  0.50      A   

ATOM     24  CD1 TYR A   3       0.511  -4.796  -9.241  1.00  0.50      A   

ATOM     25  CG  TYR A   3       0.592  -4.675  -7.971  1.00  0.50      A   

ATOM     26  OH  TYR A   3      -0.955  -7.314 -10.505  1.00  0.50      A   

ATOM     27  N   LYS A   4       3.813  -2.410  -6.913  1.00  0.50      A   

ATOM     28  CA  LYS A   4       5.305  -1.708  -6.190  1.00  0.50      A   

ATOM     29  C   LYS A   4       5.484  -1.490  -4.332  1.00  0.50      A   

ATOM     30  O   LYS A   4       6.060  -1.934  -3.282  1.00  0.50      A   

ATOM     31  CB  LYS A   4       6.471  -3.020  -5.844  1.00  0.50      A   

ATOM     32  CG  LYS A   4       7.990  -3.143  -6.577  1.00  0.50      A   

ATOM     33  CD  LYS A   4       8.525  -2.078  -7.780  1.00  0.50      A   

ATOM     34  CE  LYS A   4       7.601  -0.784  -8.357  1.00  0.50      A   

ATOM     35  NZ  LYS A   4       6.045  -0.430  -7.795  1.00  0.50      A   

ATOM     36  N   LEU A   5       4.642  -0.488  -4.772  1.00  0.50      A   

ATOM     37  CA  LEU A   5       3.890   0.514  -3.479  1.00  0.50      A   

ATOM     38  C   LEU A   5       2.776  -0.248  -2.172  1.00  0.50      A   

ATOM     39  O   LEU A   5       2.694  -0.589  -0.944  1.00  0.50      A   

ATOM     40  CB  LEU A   5       4.988   0.586  -2.069  1.00  0.50      A   

ATOM     41  CG  LEU A   5       5.381   2.281  -1.775  1.00  0.50      A   

ATOM     42  CD1 LEU A   5       4.850   2.720  -0.136  1.00  0.50      A   

ATOM     43  CD2 LEU A   5       7.175   2.449  -1.927  1.00  0.50      A   

ATOM     44  N   ASN A   6       1.122  -0.844  -4.154  1.00  0.50      A   

ATOM     45  CA  ASN A   6       1.325  -0.294  -2.451  1.00  0.50      A   

ATOM     46  C   ASN A   6      -0.141  -0.153  -1.287  1.00  0.50      A   

ATOM     47  O   ASN A   6      -0.726  -0.677  -0.280  1.00  0.50      A   

ATOM     48  CB  ASN A   6       1.635  -1.715  -1.397  1.00  0.50      A   

ATOM     49  CG  ASN A   6       3.212  -0.743  -1.086  1.00  0.50      A   

ATOM     50  OD1 ASN A   6       3.850   0.324  -1.373  1.00  0.50      A   

ATOM     51  ND2 ASN A   6       3.252  -2.334  -0.078  1.00  0.50      A   

ATOM     52  N   ASN A   7      -0.135   1.054  -1.971  1.00  0.50      A   

ATOM     53  CA  ASN A   7      -1.752   1.825  -2.160  1.00  0.50      A   

ATOM     54  C   ASN A   7      -3.307   0.795  -2.382  1.00  0.50      A   

ATOM     55  O   ASN A   7      -4.377   0.388  -1.815  1.00  0.50      A   

ATOM     56  CB  ASN A   7      -2.500   2.050  -0.544  1.00  0.50      A   

ATOM     57  CG  ASN A   7      -2.437   3.839  -1.112  1.00  0.50      A   

ATOM     58  OD1 ASN A   7      -2.095   4.616  -2.067  1.00  0.50      A   

ATOM     59  ND2 ASN A   7      -3.201   3.760   0.606  1.00  0.50      A   

ATOM     60  N   THR A   8      -2.792   0.910  -3.666  1.00  0.50      A   

ATOM     61  CA  THR A   8      -3.179  -0.463  -4.764  1.00  0.50      A   

ATOM     62  C   THR A   8      -3.314  -2.222  -4.118  1.00  0.50      A   

ATOM     63  O   THR A   8      -4.123  -3.170  -3.838  1.00  0.50      A   

ATOM     64  CB  THR A   8      -4.947  -0.463  -4.924  1.00  0.50      A   

ATOM     65  OG1 THR A   8      -5.217  -0.139  -6.640  1.00  0.50      A   

ATOM     66  CG2 THR A   8      -5.838  -1.985  -4.437  1.00  0.50      A   

ATOM     67  N   VAL A   9      -0.740  -2.032  -3.518  1.00  0.50      A   

ATOM     68  CA  VAL A   9      -2.091  -3.053  -4.134  1.00  0.50      A   

ATOM     69  C   VAL A   9      -1.878  -4.900  -4.402  1.00  0.50      A   

ATOM     70  O   VAL A   9      -2.175  -6.058  -3.954  1.00  0.50      A   

ATOM     71  CB  VAL A   9      -3.079  -3.446  -2.712  1.00  0.50      A   

ATOM     72  CG1 VAL A   9      -4.637  -2.688  -3.055  1.00  0.50      A   

ATOM     73  CG2 VAL A   9      -3.327  -5.216  -2.322  1.00  0.50      A   

ATOM     74  N   GLY A  10      -1.232  -4.269  -5.447  1.00  0.50      A   

ATOM     75  CA  GLY A  10      -0.298  -5.347  -6.546  1.00  0.50      A   

ATOM     76  C   GLY A  10       1.128  -6.391  -5.911  1.00  0.50      A   

ATOM     77  O   GLY A  10       1.501  -7.577  -5.620  1.00  0.50      A   

ATOM     78  N   ASP A  11       1.704  -5.157  -6.177  1.00  0.50      A   

ATOM     79  CA  ASP A  11       3.131  -4.752  -5.155  1.00  0.50      A   

ATOM     80  C   ASP A  11       3.243  -5.310  -3.365  1.00  0.50      A   

ATOM     81  O   ASP A  11       3.814  -6.122  -2.561  1.00  0.50      A   

ATOM     82  CB  ASP A  11       4.367  -6.043  -5.316  1.00  0.50      A   

ATOM     83  CG  ASP A  11       5.364  -4.576  -5.934  1.00  0.50      A   

ATOM     84  OD1 ASP A  11       5.333  -3.320  -6.166  1.00  0.50      A   

ATOM     85  OD2 ASP A  11       6.437  -6.123  -5.987  1.00  0.50      A   

ATOM     86  N   TYR A  12       1.139  -3.764  -2.916  1.00  0.50      A   

ATOM     87  CA  TYR A  12       2.720  -4.395  -2.329  1.00  0.50      A   

ATOM     88  C   TYR A  12       3.302  -4.092  -0.568  1.00  0.50      A   

ATOM     89  O   TYR A  12       3.489  -4.631   0.573  1.00  0.50      A   

ATOM     90  CB  TYR A  12       2.491  -6.033  -1.651  1.00  0.50      A   

ATOM     91  CD2 TYR A  12       3.187  -7.764  -2.023  1.00  0.50      A   

ATOM     92  CE2 TYR A  12       3.645  -8.923  -2.288  1.00  0.50      A   

ATOM     93  CZ  TYR A  12       4.479  -9.075  -3.246  1.00  0.50      A   

ATOM     94  CE1 TYR A  12       4.843  -8.071  -3.940  1.00  0.50      A   

ATOM     95  CD1 TYR A  12       4.386  -6.912  -3.674  1.00  0.50      A   

ATOM     96  CG  TYR A  12       3.552  -6.755  -2.717  1.00  0.50      A   

ATOM     97  OH  TYR A  12       5.538  -9.801  -4.317  1.00  0.50      A   

ATOM     98  N   PHE A  13       3.695  -2.951  -1.255  1.00  0.50      A   

ATOM     99  CA  PHE A  13       3.776  -1.456  -0.255  1.00  0.50      A   

ATOM    100  C   PHE A  13       2.575  -1.156   1.157  1.00  0.50      A   

ATOM    101  O   PHE A  13       2.448  -1.125   2.427  1.00  0.50      A   

ATOM    102  CB  PHE A  13       4.871  -1.729   1.132  1.00  0.50      A   

ATOM    103  CG  PHE A  13       6.471  -0.927   1.776  1.00  0.50      A   

ATOM    104  CD1 PHE A  13       7.551  -0.395   2.191  1.00  0.50      A   

ATOM    105  CE1 PHE A  13       8.073   0.578   1.546  1.00  0.50      A   

ATOM    106  CZ  PHE A  13       7.518   1.008   0.483  1.00  0.50      A   

ATOM    107  CE2 PHE A  13       6.437   0.476   0.067  1.00  0.50      A   

ATOM    108  CD2 PHE A  13       5.911  -0.495   0.710  1.00  0.50      A   

TER

END

AAS15574_fragment_Ser386-Asn394.pdb

ATOM      1  N   SER A   1       4.971  -0.694  -6.077  1.00  0.50      A   

ATOM      2  CA  SER A   1       4.591   1.053  -5.875  1.00  0.50      A   

ATOM      3  C   SER A   1       3.482   1.660  -4.485  1.00  0.50      A   

ATOM      4  O   SER A   1       3.457   2.273  -3.365  1.00  0.50      A   

ATOM      5  CB  SER A   1       5.820   1.810  -4.819  1.00  0.50      A   

ATOM      6  OG  SER A   1       6.597   3.104  -5.732  1.00  0.50      A   

ATOM      7  N   CYS A   2       2.596   1.297  -5.490  1.00  0.50      A   

ATOM      8  CA  CYS A   2       0.980   0.750  -4.913  1.00  0.50      A   

ATOM      9  C   CYS A   2       0.785  -0.198  -3.304  1.00  0.50      A   

ATOM     10  O   CYS A   2       0.383  -0.124  -2.094  1.00  0.50      A   

ATOM     11  CB  CYS A   2       0.248   2.028  -3.899  1.00  0.50      A   

ATOM     12  SG  CYS A   2      -1.280   2.501  -4.642  1.00  0.50      A   

ATOM     13  N   ILE A   3       2.213  -2.116  -4.444  1.00  0.50      A   

ATOM     14  CA  ILE A   3       0.838  -1.674  -3.369  1.00  0.50      A   

ATOM     15  C   ILE A   3      -0.061  -2.969  -2.348  1.00  0.50      A   

ATOM     16  O   ILE A   3      -0.237  -3.428  -1.170  1.00  0.50      A   

ATOM     17  CB  ILE A   3       1.577  -1.102  -1.859  1.00  0.50      A   

ATOM     18  CG1 ILE A   3       1.080   0.589  -1.757  1.00  0.50      A   

ATOM     19  CG2 ILE A   3       1.122  -1.972  -0.316  1.00  0.50      A   

ATOM     20  CD1 ILE A   3       0.113   0.962  -3.149  1.00  0.50      A   

ATOM     21  N   ASP A   4      -0.683  -3.023  -3.588  1.00  0.50      A   

ATOM     22  CA  ASP A   4      -1.373  -4.630  -4.020  1.00  0.50      A   

ATOM     23  C   ASP A   4      -0.546  -6.227  -3.477  1.00  0.50      A   

ATOM     24  O   ASP A   4      -0.624  -7.221  -2.680  1.00  0.50      A   

ATOM     25  CB  ASP A   4      -2.523  -5.149  -2.742  1.00  0.50      A   

ATOM     26  CG  ASP A   4      -3.685  -5.116  -4.217  1.00  0.50      A   

ATOM     27  OD1 ASP A   4      -3.771  -4.884  -5.470  1.00  0.50      A   

ATOM     28  OD2 ASP A   4      -4.642  -5.647  -2.683  1.00  0.50      A   

ATOM     29  N   THR A   5       0.115  -5.884  -4.648  1.00  0.50      A   

ATOM     30  CA  THR A   5       1.822  -6.449  -4.746  1.00  0.50      A   

ATOM     31  C   THR A   5       2.911  -6.543  -3.218  1.00  0.50      A   

ATOM     32  O   THR A   5       3.464  -7.332  -2.380  1.00  0.50      A   

ATOM     33  CB  THR A   5       1.741  -8.223  -4.709  1.00  0.50      A   

ATOM     34  OG1 THR A   5       2.393  -8.710  -6.277  1.00  0.50      A   

ATOM     35  CG2 THR A   5       2.648  -9.080  -3.371  1.00  0.50      A   

ATOM     36  N   CYS A   6       2.669  -3.908  -3.077  1.00  0.50      A   

ATOM     37  CA  CYS A   6       3.725  -5.354  -2.884  1.00  0.50      A   

ATOM     38  C   CYS A   6       5.424  -5.227  -2.093  1.00  0.50      A   

ATOM     39  O   CYS A   6       6.108  -5.492  -1.048  1.00  0.50      A   

ATOM     40  CB  CYS A   6       3.382  -6.134  -1.311  1.00  0.50      A   

ATOM     41  SG  CYS A   6       2.861  -7.789  -1.628  1.00  0.50      A   

ATOM     42  N   GLU A   7       5.645  -4.897  -3.423  1.00  0.50      A   

ATOM     43  CA  GLU A   7       7.022  -3.772  -3.705  1.00  0.50      A   

ATOM     44  C   GLU A   7       7.452  -2.423  -2.471  1.00  0.50      A   

ATOM     45  O   GLU A   7       8.286  -2.057  -1.576  1.00  0.50      A   

ATOM     46  CB  GLU A   7       8.512  -4.470  -3.003  1.00  0.50      A   

ATOM     47  CG  GLU A   7       9.679  -4.519  -4.335  1.00  0.50      A   

ATOM     48  CD  GLU A   7      10.767  -3.440  -3.250  1.00  0.50      A   

ATOM     49  OE1 GLU A   7      10.814  -2.750  -2.182  1.00  0.50      A   

ATOM     50  OE2 GLU A   7      11.758  -4.022  -4.748  1.00  0.50      A   

ATOM     51  N   LYS A   8       6.463  -1.855  -3.262  1.00  0.50      A   

ATOM     52  CA  LYS A   8       5.453  -0.613  -2.437  1.00  0.50      A   

ATOM     53  C   LYS A   8       5.027  -0.753  -0.613  1.00  0.50      A   

ATOM     54  O   LYS A   8       5.262  -0.282   0.550  1.00  0.50      A   

ATOM     55  CB  LYS A   8       6.510   0.671  -1.782  1.00  0.50      A   

ATOM     56  CG  LYS A   8       6.448   2.285  -2.285  1.00  0.50      A   

ATOM     57  CD  LYS A   8       5.432   2.828  -3.526  1.00  0.50      A   

ATOM     58  CE  LYS A   8       4.374   1.816  -4.375  1.00  0.50      A   

ATOM     59  NZ  LYS A   8       4.233   0.158  -4.073  1.00  0.50      A   

ATOM     60  N   ASN A   9       3.695  -2.951  -1.255  1.00  0.50      A   

ATOM     61  CA  ASN A   9       3.776  -1.456  -0.255  1.00  0.50      A   

ATOM     62  C   ASN A   9       2.575  -1.156   1.157  1.00  0.50      A   

ATOM     63  O   ASN A   9       2.448  -1.125   2.427  1.00  0.50      A   

ATOM     64  CB  ASN A   9       4.872  -1.729   1.140  1.00  0.50      A   

ATOM     65  CG  ASN A   9       5.767  -0.299   0.313  1.00  0.50      A   

ATOM     66  OD1 ASN A   9       5.744   0.512  -0.671  1.00  0.50      A   

ATOM     67  ND2 ASN A   9       6.714  -0.816   1.858  1.00  0.50      A   

TER

END

AAS15574_fragment_Ser593-Leu599.pdb

ATOM      1  N   SER A   1       9.905  -2.381  -7.777  1.00  0.50      A   

ATOM      2  CA  SER A   1       8.585  -1.229  -8.195  1.00  0.50      A   

ATOM      3  C   SER A   1       7.329  -0.673  -6.914  1.00  0.50      A   

ATOM      4  O   SER A   1       6.954   0.299  -6.177  1.00  0.50      A   

ATOM      5  CB  SER A   1       9.152   0.445  -7.926  1.00  0.50      A   

ATOM      6  OG  SER A   1       9.041   1.309  -9.460  1.00  0.50      A   

ATOM      7  N   THR A   2       5.932  -1.534  -6.623  1.00  0.50      A   

ATOM      8  CA  THR A   2       6.693  -3.126  -6.986  1.00  0.50      A   

ATOM      9  C   THR A   2       6.863  -4.452  -5.667  1.00  0.50      A   

ATOM     10  O   THR A   2       6.420  -5.579  -5.259  1.00  0.50      A   

ATOM     11  CB  THR A   2       5.409  -4.114  -7.712  1.00  0.50      A   

ATOM     12  OG1 THR A   2       5.992  -4.431  -9.349  1.00  0.50      A   

ATOM     13  CG2 THR A   2       4.994  -5.694  -6.889  1.00  0.50      A   

ATOM     14  N   ALA A   3       7.978  -3.647  -5.482  1.00  0.50      A   

ATOM     15  CA  ALA A   3       8.601  -3.592  -3.793  1.00  0.50      A   

ATOM     16  C   ALA A   3       7.441  -3.691  -2.319  1.00  0.50      A   

ATOM     17  O   ALA A   3       7.027  -4.435  -1.368  1.00  0.50      A   

ATOM     18  CB  ALA A   3       8.961  -5.253  -3.239  1.00  0.50      A   

ATOM     19  N   VAL A   4       6.730  -2.331  -1.669  1.00  0.50      A   

ATOM     20  CA  VAL A   4       6.633  -1.477  -3.251  1.00  0.50      A   

ATOM     21  C   VAL A   4       4.979  -1.027  -4.021  1.00  0.50      A   

ATOM     22  O   VAL A   4       4.178  -0.067  -4.280  1.00  0.50      A   

ATOM     23  CB  VAL A   4       6.846   0.245  -2.878  1.00  0.50      A   

ATOM     24  CG1 VAL A   4       8.343   0.678  -3.710  1.00  0.50      A   

ATOM     25  CG2 VAL A   4       5.509   1.388  -3.380  1.00  0.50      A   

ATOM     26  N   VAL A   5       5.152  -2.383  -4.213  1.00  0.50      A   

ATOM     27  CA  VAL A   5       3.742  -3.251  -4.921  1.00  0.50      A   

ATOM     28  C   VAL A   5       2.078  -3.291  -4.050  1.00  0.50      A   

ATOM     29  O   VAL A   5       0.883  -2.842  -4.066  1.00  0.50      A   

ATOM     30  CB  VAL A   5       3.023  -2.123  -6.088  1.00  0.50      A   

ATOM     31  CG1 VAL A   5       3.213  -2.940  -7.642  1.00  0.50      A   

ATOM     32  CG2 VAL A   5       1.269  -1.663  -5.845  1.00  0.50      A   

ATOM     33  N   THR A   6       1.708  -4.455  -2.916  1.00  0.50      A   

ATOM     34  CA  THR A   6       3.405  -4.596  -2.329  1.00  0.50      A   

ATOM     35  C   THR A   6       3.873  -4.136  -0.568  1.00  0.50      A   

ATOM     36  O   THR A   6       4.210  -4.597   0.573  1.00  0.50      A   

ATOM     37  CB  THR A   6       3.609  -6.297  -1.863  1.00  0.50      A   

ATOM     38  OG1 THR A   6       4.851  -6.894  -2.968  1.00  0.50      A   

ATOM     39  CG2 THR A   6       4.103  -6.644  -0.136  1.00  0.50      A   

ATOM     40  N   LEU A   7       3.695  -2.951  -1.255  1.00  0.50      A   

ATOM     41  CA  LEU A   7       3.776  -1.456  -0.255  1.00  0.50      A   

ATOM     42  C   LEU A   7       2.575  -1.156   1.157  1.00  0.50      A   

ATOM     43  O   LEU A   7       2.448  -1.125   2.427  1.00  0.50      A   

ATOM     44  CB  LEU A   7       4.871  -1.729   1.132  1.00  0.50      A   

ATOM     45  CG  LEU A   7       6.174  -0.544   1.037  1.00  0.50      A   

ATOM     46  CD1 LEU A   7       6.159   0.449   2.511  1.00  0.50      A   

ATOM     47  CD2 LEU A   7       7.726  -1.463   0.907  1.00  0.50      A   

TER

END


Параметры некоторых программных спиралей похожи на параметры фундаментальных (альфа-, бета-, пи-, 310-) спиралей, поэтому в PDB их ошибочно могут изображать одной или даже тремя, как в случае коллагена, фундаментальными спиралями.

С уважением,

Ваш А.Кушелев

P/S

Я кажется понял, почему Пикотех 3D замыкает не все дисульфидные мостики. Программист, который делал версию в среде 3D Studio, накладывал модели аминокислотных остатков, сдвигая их до совмещения с линией вторичной структуры, полученной в предыдущей версии программы. В результате сдвиги могут компенсировать друг друга, а могут накапливаться в зависимости от конкретной последовательности триплетов. Если сдвиги компенсируются, то дисульфидный мостик замыкается, а если накапливаются, то не дотягивается. Эту проблему можно будет исправить в следующей версии путём калибровки транспозиционных углов. А в этой версии углы в модели получаются правильными, т.к. они берутся с карты Рамачандрана, где транспозиционные углы как бы учтены, т.к. это экспериментальные данные. Модель слегка деформируется за счет небольших смещений (параллельных переносов) моделей аминокислотных остатков. Короче, все не так плохо :)

Я написал письма в лаборатории кругового дихроизма. Может быть удастся проверить структуры полилизинов. А модель структуры интересующего Вас белка я буду пробовать дорабатывать в программе PyMol. Завтра планирую установить её на рабочий компьютер.

***

20 июля 2019 г. в 11:34 Александр Кушелев:

Здравствуйте, Специалист Института белка!

Я зашёл на сайт PyMol, и что-то у меня глаза разбежались: https://pymol.org/installers/

Какую версию Вы советуете установить на мой рабочий компьютер?

У меня установлена Windows 7 professional без русификатора.

Я так понял, что нужно ещё соответствующую версию языка Piton установить.

С уважением,

Ваш А.Кушелев


***

20 июля 2019 г. в 14:21 Александр Кушелев:

2019072002_picotech.rar

Здравствуйте, Специалист Института белка!

Я пытаюсь разобраться с ошибками программистов (Евгения Неделько и Дениса Савина).

В это письмо я вкладываю другой PDB-файл, полученный с помощью программы Неделько.

Любопытно, что его программа замыкает дисульфидный мостик в одном из лизоцимов, а в некоторых других не замыкает, а программа Дениса Савина, которая написана "по образу и подобию", замыкает другие дисульфидные мостики. При этом общий ход пептидных групп одинаковый. Разница только в ориентации радикалов. Подробности я разбираю на примере фрагмента лицоцима: http://nanoworld.org.ru/post/121532/#p121532

Получив PDB-файл (расширение ENT) с помощью программы Неделько, я обнаружил, что в интересующем Вас белке могут существовать дисульфидные мостики: Met524-Met542, Met569-Met582, Met573-Cys579. Наличие дисульфидных мостиков, как я понимаю, можно проверить биохимическими методами.








Ещё заметна интересная особенность фрагмента Thr145-Ala181. Не исключено, что это узел белковой цепи. Раньше мне уже попадались белки с регулярной структурой из узлов. Новый тип структуры белка я назвал "вязь":

 

Оригинал (анимация): https://img-fotki.yandex.ru/get/16130/158289418.41d/0_17a942_7ca5bc28_orig.gif

Это его идентификатор и вторичная структура в компактном представлении:


Оригинал: https://img-fotki.yandex.ru/get/53078/158289418.41d/0_17a938_6c033a0f_orig.png

Если узлы белковой структуры действительно существуют, то это может сильно изменить представление о механизме синтеза белка, согласитесь :)

Далее в структуре AAS15574_fragment_Thr204-Thr240 обнаружился фрагмент с длинным циклом. Пока непонятно, как этот цикл стабилизируется, но его существование, вероятно, тоже можно проверить экспериментально.

Я склоняюсь к тому, что нужно напрячь программистов, чтобы они исправили ошибки и доделали интерактивную версию программы, когда можно будет постепенно строить модель и после добавления очередного жесткого участка укладывать его вручную, а потом и в автоматическом режиме. Ручная укладка при наличии ошибок в программе не даст правильного результата по любому. Придется сначала исправлять ошибки в ориентации аминокислотных остатков.

Мой программист может совершенствовать 2D версию, а для работы с 3D версией нужно искать программиста. Мои инвесторы в настоящее время финансируют другие научные направления лаборатории Наномир, поэтому может быть имеет смысл подключить Ваших программистов?

С уважением,

Ваш А.Кушелев

***

20 июля 2019 г. в 18:22 Специалист Института белка:

Здравствуйте!

Сами версии PyMol мало чем между собой различаются, но разработчики всегда советуют устанавливать последние версии.

Да, PyMol работает на языке Piton

***

20 июля 2019 г. в 18:24 Специалист Института белка: Здравствуйте!

К сожалению, у нас нет таких программистов, способных здесь что-либо сделать

***

20 июля 2019 г. в 21:51 Александр Кушелев:

Я предполагаю, что интерактивную версию Пикотех 3D лучше написать в среде одного из PDB-редакторов в виде скрипта. Для базы данных PDB модели создают в PDB-редакторах. Нужно выбрать PDB-редактор, где можно автоматизировать процесс сборки с помощью скрипта. Программу Пикотех 3D я сам могу попробовать написать в виде такого скрипта, т.к. алгоритм там очень простой. Нужно присоединять модель очередного аминокислотного остатка, затем поворачивать всю модель белка на композиционный и транспозиционный углы, после чего продвигать на длину пептидной связи. А композиционный (3D) генетический код можно задать прямо в скрипте, как я делал в случае скрипта для 3D Studio. Программист понадобится, если нужно будет запрограммировать ввод файла fasta и по нему через таблицу 3D генетического кода собирать модель белка.

 Вы или Ваши коллеги делали модели для базы данных PDB? Если да, то нужен Ваш совет по поводу выбора PDB-редактора. А если нет, то нужно найти тех, кто делал. Если начинать с нуля, то это может затянуться на долго, а мне хотелось бы в ближайшие дни собрать модель белка, которая Вас интересует.

С уважением, Ваш А.Кушелев

***

21 июля 2019 г. в 0:59 Александр Кушелев:

Здравствуйте, Специалист Института белка!

 Я изучаю сайт: http://www.bioinformatics.org/pdbeditor/wiki/

 Цитата:

General Features

Search and edit (in parallel) coordinates based on conditions user specifies

Quickly extract and write selected data in tab delimited format to analyze in spreadsheet or other statistical programs using clipboard action (cut + copy + paste)

Quickly amend atoms and spacegroup by clipboard action

Manipulate atoms in fractional coordinates

Edit spacegroup and calculate SCALE matrix

Arrange / sort / correct atom orderings

Перевод:

Основные характеристики

Поиск и редактирование (параллельно) координат в зависимости от условий, указанных пользователем

Быстрое извлечение и запись выбранных данных в формате с разделителями табуляции для анализа в электронной таблице или других статистических программах с использованием действия буфера обмена (вырезать + копировать + вставить)

Быстро изменить атомы и космические группы с помощью действия буфера обмена

Манипулировать атомами в дробных координатах

Редактировать spacegroup и вычислять SCALE матрицу

Упорядочить / отсортировать / исправить порядок атомов

Конец цитаты.

Вероятно, это типовые возможности PDB-редакторов. Осталось выяснить, может этот или другой редактор создавать модель белка по командам скрипта типа: Поставить аминокислотный остаток, например, Gly в положение альфа-спирали (пи-, бета-, 310-, произвольное положение). Для всех аминокислотных остатков, кроме метионина подойдут стардантные положения, а метионин нужно устанавливать с дополнительным поворотом, т.к. его радикал попадает в зону водородной связи и как бы удлиняет её на один атом.

Кто-то мне показывал белковый виртуальный конструктор, но там в то время не было скриптов для автоматической сборки модели белка. А должны быть редакторы, где хотя бы альфа-спирали собираются автоматически.

Может быть нужно искать не PDB file editor, а PDB file generator? :)

С уважением,

Ваш А.Кушелев

***

21 июля 2019 г. в 12:02 Специалист Института белка:

Здравствуйте!

Для сборки молекул белка мы ранее пользовались онлайн-программой https://swissmodel.expasy.org/

Правда, я не знаю, может ли этот редактор создавать модель белка по обозначенным командам скрипта

***

21 июля 2019 г. в 12:08 Александр Кушелев:

Здравствуйте, Специалист Института белка!

Благодарю! Сейчас попробую разобраться...

***

21 июля 2019 г. в 12:43 Александр Кушелев:

Здравствуйте, Специалист Института белка!

 https://swissmodel.expasy.org/ предлагает только свою модель по аминокислотной последовательности.

 Я пытаюсь связаться со специалистами с факультета биоинформатики МГУ. Может быть они подскажут, в какой программе уровня RasMol можно писать скрипт с командами вращения, перемещения и соединения моделей аминокислотных остатков в модель белка. Может быть последние версии PyMol имеют такие возможности?

 Мне интересно написать скрипт для наиболее мощной и популярной системы типа RasMol. В этом случае мы раньше получим результат, чем если работать в неудобных и слабых программах.

С уважением,

Ваш А.Кушелев

***

21 июля 2019 г. в 21:19 Александр Кушелев: 

Здравствуйте, Специалист Института белка!

Нашёл скрипт для Jmol, который строит альфа-спирали:

http://wiki.jmol.org/index.php/Recycling_Corner/Alpha_Helix_Generator

С помощью этого скрипта вы можете сгенерировать полипептидную альфа-спиральную цепь из последовательности в 1-символьной аминокислотной кодировке...

Этот скрипт можно модифицировать и строить модели белков по 3D генетическому коду в программе Jmol.

Буду пробовать...

С уважением,

Ваш А.Кушелев

***

23 июля 2019 г. в 18:22 Специалист Института белка:

Здравствуйте!

У вас получилось?

***

23 июля 2019 г. в 23:41 Александр Кушелев:

Как изменилась форма белка AAS15574 с учётом структуры Met, можно посмотреть здесь: http://nanoworld.org.ru/post/121656/#p121656

Осталось решить задачу укладки структуры на пролинах. Программист написал, что хочет доделать программу для укладки. Может быть в ближайшие дни у него получится.

С уважением,

Ваш А.Кушелев

***

24 июля 2019 г. в 19:35 Александр Кушелев:

Здравствуйте, Специалист Института белка!

Здесь можно увидеть модель белка с учетом структуры Met (исправленный вариант) и скрипт, где заготовлены пролиновые углы для укладки жестких участков: http://nanoworld.org.ru/topic/2078/page/73/

Осталось разобраться, по какому направлению гнуть, и можно начинать укладку.

С метионином направление изгиба удалось определить быстро. С пролином будет сложнее, но тоже решаемо.

С уважением,

Ваш А.Кушелев

***

29 июля 2019 г. в 22:50 Специалист Института белка:

Здравствуйте!

Можно узнать о результатах, или может быть, есть какие-нибудь трудности?

***

30.07.2019 1:59:27 Александр Кушелев:

Здравствуйте, Специалист Института белка! 

В своём скрипте я добавил угол для Met и возможность настройки угла для Pro, но мой скрипт не показывает радикалов, что сильно затрудняет процесс укладки жёстких участков. Поэтому саму настройку углов Pro придётся делать уже в полноценной программе. Либо в модифицированном скрипте для 3D Studio, либо в модифицированном скрипте для MatLab, Эти скрипты могут и PDB-файл сохранять. Но без программиста я не могу вставить алгоритм настройки в эти скрипты. Я программисту написал. Он ответил, что сделает, но он сейчас в отпуске, поэтому непонятно, когда он сделает. Я ему объяснил, что дело важное, он вроде понял, но пока не сообщает о каких-либо результатах. Придётся несколько дней подождать, а потом я его спрошу.

С уважением,

Ваш А. Кушелев.

***

4 августа 2019 г. в 11:30 Александр Кушелев:

Привет, Валентин!

Ты вернулся?

Твой Кушелев

***

4 августа 2019 г. в 20:31 Валентин Я:

да. вот приехал домой. дома. читаю почту.

***

4 августа 2019 г. в 23:40 Александр Кушелев:

Ура!

***

7 августа 2019 г. в 13:22 Валентин Я:

вечером свяжусь (почтой) править код будем

*** 

7 августа 2019 г. в 15:49 Александр Кушелев:

Ура!

15 августа 2019, 21:32 +05:00 Специалист Института белка:

Здравствуйте!

Уже ура или еще нет?

***

15 апреля 2022 Валентин:

Пико 3D - пройденные шаги: 1 шаг – вычислили начальную модель (вершины, связи, углы) и её размещение

 

Будем считать данную заготовку максимально приближенной к правильному геометрическому варианту (хотя конечно понимаем, что совпадение весьма условное).

2-3-4 шаги – мы сдвигали, вращали и снова вращали эту заготовку – проверяли элементы будущих формирований цепочки.

5 шаг – ты понял, что пройденный путь не совсем то, или совсем не то, и мы изменили и заготовку, и её местоположение. А ещё понадобились «хвостики» и получили такой вот результат.

 

На этом результате мы остановились, потому что мы (и в первую очередь естественно я) перестали понимать (а ты так точно оказалось, что не знаешь) как реально расположены N, HA и CB. В итоге после некоторых дебатов, ты мне накидал вот такой набор PDB-шек

 

И сказал, чтобы я оные «притягивал» геометрически к полученной «новой» заготовке, а N, HA и CB сами по себе станут на место.

Ну ладненько, видимо снова надо решать пачку геометрических задач на «притягивание» одной заготовки к другой.

я взял «Ala_mirror.pdb, визуализировал её и «завис»:

 

И начал спрашивать – «какую вершину к какой притягивать?»

Вот на этой вопросительной ноте мы с тобой и остановились. Ответа я не получил, ковырять остальные 22 файла без понимания «что к чему» мне тоже как-то не весело. А тебе почему-то лениво показать связи между тем, что мы определили в первоначальном виде и тем что ты наприсылал.

А вот например «Tyr.pdb» вообще ставит меня в ступор.


Не удивлюсь, что тебе эти файлы подогнал твой, как ты сказал, «консультант». А ты лично без понятия и сам лично не смотрел их.

Так что двигаться далее не могу и ЖДУ. Или твоих указаний или подсказок «консультанта».

[14:35, 15.04.2022] Александр Кушелев: Для начала надо совместить С=O. С с С, потом О с О. А потом совместить Сальфа с Сальфа. Ну и радикал встанет, как надо.
[14:43, 15.04.2022] Валентин: а конкретнее
из файла All_miror.pdb
HEADER    Structure from MOLMOL 
COMPND    Ala 
ATOM      1  N   ALA     1      -0.188  -1.429   0.729  1.00  0.00
ATOM      2  HN  ALA     1      -1.049  -1.178   1.192  1.00  0.00
ATOM      3  CA  ALA     1       0.374  -0.502  -0.232  1.00  0.00
ATOM      4  HA  ALA     1       0.450  -0.997  -1.200  1.00  0.00
ATOM      5  QB  ALA     1      -0.764   0.997  -0.398  1.00  0.00
ATOM      6  CB  ALA     1      -0.545   0.709  -0.366  1.00  0.00
ATOM      7 1HB  ALA     1      -0.131   1.400  -1.100  1.00  0.00
ATOM      8 2HB  ALA     1      -1.532   0.382  -0.692  1.00  0.00
ATOM      9 3HB  ALA     1      -0.628   1.210   0.598  1.00  0.00
ATOM     10  C   ALA     1       1.765  -0.076   0.215  1.00  0.00
ATOM     11  O…
и вообще, я с того "файла" начал ? может надо другой "файл" совмещать ?
[16:47, 15.04.2022] Александр Кушелев: Аланин (Ala) самый подходящий. Там радикал из 1 атома углерода и 3 атомов водорода, присобаченных к нему.
На твоей картинке я номеров не вижу. Кислород из группы C=O у тебя на картинке вверху. К нему присобачен С.
В распечатке атом кислорода идёт под номером 11, а атом С группы СО под номером 10
Радикал CB состоит из атома углерода и из трёх протонов, т.е. атомов водорода.
[21:29, 15.04.2022] Валентин: на картинке номеров нет и не может быть - ты мне их не давал и не назначал в процессе подготовки заготовки

в итоге я правильно тебя понял?:
O на картинке - это 11я позиция
С на картинке - это 10я позиция
Сальфа на картинке - это непонятная тебе позиция и значит неясно как в итоге провести последнее совмещение Сальфа
[21:44, 15.04.2022] Александр Кушелев: Сальфа - третья позиция
[21:44, 15.04.2022] Валентин: ура )
Саша, а расскажи мне, какие правила соединения  атомов или связей между атомами применяются при прочтении PDB формата данных ?
в самом файле не прописаны связи между атомами, только их координаты. Но тем не менее вьюверы показывают связи и не ошибаются (наверное)
[00:38, 16.04.2022] Александр Кушелев: Я не в курсе. Вероятно, где-то описано в стандартах. Скорее всего соединяются те ядра, расстояние между которыми не превышают длины межъядерных связей в типовых соединениях таких атомов.

 Обсуждение: kushelev20120@yandex.ru


В избранное